KEGG   Gallus gallus (chicken): 428659
Entry
428659            CDS       T01006                                 
Symbol
CAD
Name
(RefSeq) CAD protein isoform X1
  KO
K11540  carbamoyl-phosphate synthase / aspartate carbamoyltransferase / dihydroorotase [EC:6.3.5.5 2.1.3.2 3.5.2.3]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00240  Pyrimidine metabolism
gga00250  Alanine, aspartate and glutamate metabolism
gga01100  Metabolic pathways
gga01240  Biosynthesis of cofactors
Module
gga_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    428659 (CAD)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    428659 (CAD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    428659 (CAD)
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     428659 (CAD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.3  dihydroorotase
     428659 (CAD)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     428659 (CAD)
Peptidases and inhibitors [BR:gga01002]
 Cysteine peptidases
  Family C26: gamma-glutamyl hydrolase family
   428659 (CAD)
 Metallo peptidases
  Family M38: beta-aspartyl dipeptidase family
   428659 (CAD)
SSDB
Motif
Pfam: CPSase_L_D2 CPSase_sm_chain GATase OTCace_N OTCace CPSase_L_D3 Dala_Dala_lig_C MGS ATP-grasp ATPgrasp_Ter Amidohydro_1 ATP-grasp_3 Peptidase_C26 GARS_A GSH-S_ATP
Other DBs
NCBI-GeneID: 428659
NCBI-ProteinID: XP_015140475
CGNC: 12378
Position
3:104489792..104502094
AA seq 2255 aa
MGRLVLQDGSVLRGRAFGATGAAASGEVVFQTGVVGYPEALTDPSYAAQILVLTYPLVGN
YGVPRERRGPFGLGTWFESDKIHVAALVVGECSETPSHWSAARSLDRWLKEHNVPGLEGV
DTRALTKKIREKGTLLGKLLPDEAPEESIPFQDPNERHLVQEVSLKEPRVFNPGGSPRIT
AVDCGLKHNQLRCLCERGAAVSVVPWDHPLDPADFDGLFLSNGPGDPRLCQQTVANLRAV
LAADHPKPIFGVCLGHQLLALALGARTYKMKYGNRGHNQPCVHEDTQRCFITAQNHGFAV
EAGSLPPGWAPLFTNANDGSNEGLVHEHKPFFSVQFHPEHRAGPTDLEGLFDVFVEAARD
LQGGNNDRTVRQRLRDLLAYKEVPAAGQEAARPRKVLILGSGGLSIGQAGEFDYSGSQAI
KALKEENIQTVLINPNIATVQTSKGLADKVYFLPITPEYVTQVIRNERPDGVLLTFGGQT
ALNCGVELTKGGVLQRYRVRVLGTPVASIEMTEDRKVFVEKMEEIGEHVAPSKAAASLEQ
AQAAAERLGYPVLVRSAYALGGLGSGFASNREELAALVSQAFTHTSQVLVDKSLKGWKEI
EYEVVRDAYNNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDTEYFMLRHTAIKVVQHLG
IVGECNIQFALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPVLRN
SVTNSTTANFEPSLDYCVVKIPRWDLSKFLRVSTKIGSSMKSVGEVMAIGRNFEEAFQKA
LRMVDENCVGFDHTVKPASDVELETPTDKRIFVLAAALRAGYSIERLYELTKIDRWFLHK
MKNITDHAARLEAFRGEQSAMPPAVLRRAKQLGFSDKQVALAVLSTELAVRKMRRDLGIL
PVVKQIDTVAAEWPAQTNYLYLTYNGAEHDLPFRQPHVMVIGSGVYRIGSSVEFDWCAVG
CIQELRKMGFKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGG
QLPNNIAMALHRQQCRILGTSPEAIDSAENRFKFSRLLDTIGISQPLWKELSDMESAKHF
CCTVGYPCVVRPSYVLSGAAMNVAYSDSDLEKFLSNAVAVSKEQPVVISKFIQEAKEIDV
DAVACDGVVVAIAISEHVENAGVHSGDATLVTPPQDITPKTLERIKAIVHAIGQELQVTG
PFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALASQVIMGEDVQPVGLMTGTG
IVGVKVPQFSFSRLAGADVVLGVEMTSTGEVACFGENRCEAYLKAMLSTGFKIPKKNILL
TIGSYKNKSELLPTVRTLESLGYNLYASLGTADFYTEHGIKVMAVDWHFEEADSTEAGAR
ETQRSILDYLAENHFEMVINLSMRNSGGRRLSSFVTKGYRTRRLAVDYSVPLIIDIKCTK
LFVEALGQIGAAPPLKMHVDCMTSQKLIRLPGLIDVHVHLREPGATHKEDFSSGTAAALA
GGVTMVCAMPNTSPAITDAASFALAQKLAEAGARCDFALFLGASAENVGSLGALAAAAAG
LKLYLNDTFSSLRMDDVSLWMEHFQQWPRHLPIVAHAEGQTVAAVLMVAQLHQRPVHICH
VARREEILLIKAAKQKGIPVTCEVAPHHLFLCQDDLGRLGEGCGTVRPALGTSQDLEALW
ENMDTIDCFATDHAPHTLEEKRGPKPPPGFPGLETMLPLLLTAVSEGRLTVEDIILRLYE
NPRKIFGLPAQEDTYVEVDLEQEWVIPERTAFSKAQWTPFEGRNVKGTVRRVVLRGEVAY
IDGQVLVPPGYGQDVRKWPMGAVLAPLVAPTKEIVKTPERPRHAAVGETLRSRASSPRRA
GPVPEGRFHLPPRIHRASDPGLPAFRRLGAAHRPGARGTAEDTREKAGRRAAEADATAAQ
DSHPHLSGPFPRQASPQGVPHFPTSPLLHPLVGQHILSVRQFSKEQMSHLFNVAHTLRML
VQKERSLDILKGKVMASMFYEASTRTSSSFAAAMCRLGGSVVSFCEATSSVQKGESLADS
VQTMCCYADVLVLRHPQPGAVELAATHCRKPVINAGDGVGEHPTQALLDIFTIREELGTV
NGMTITMVGDLKHGRTVHSLARLLTQYRVHLRYVTPRGLGMPPDIAAFVASKGISQEEFG
SIEEALPDTDVLYMTRIQRERFESAEEYEACFGQFILTPHIMTRAKEKMVVMHPMPRVNE
ISVEVDSDPRAAYFRQAEQGMYVRMALLATVLGRY
NT seq 6768 nt   +upstreamnt  +downstreamnt
atgggccgcctggtgcttcaggacggctccgtgctgcgcggccgcgccttcggggctacg
ggcgctgccgccagcggggaagtggtgttccagacgggcgtcgtggggtaccccgaggcg
ctcaccgacccgtcgtacgcggcgcagatcctggtgctcacctacccgttggtgggcaac
tacggcgtgccccgggagcggcggggacccttcggcctgggcacgtggttcgagtcggat
aagatccacgtggccgcgctggtggtgggagagtgctcggagacccccagccattggagc
gccgcccgatccctcgaccgatggctcaaggagcacaacgtccccgggctggaaggggtg
gacacccgcgccctcaccaagaagatccgcgagaagggcacgctgctgggcaagctgctg
ccggacgaggccccggaggagagcatccccttccaggacccaaatgagcggcacttggtg
caggaggtgtccctgaaggagccgcgtgtctttaaccccggtggatccccgcgcatcacc
gctgtggactgcggcctgaagcacaaccagctgcggtgcctctgcgagcggggggcggcc
gtcagcgtggtgccgtgggaccatccgctggaccccgccgacttcgatgggctcttcctc
agcaacggccccggggacccgcggctgtgccagcagacagtggccaacctgcgcgccgtg
ctggccgctgaccaccccaagcccatcttcggggtgtgcctgggccaccagctgctggcc
ctggccctgggcgcccgcacctataagatgaagtatgggaaccgtgggcacaaccagccg
tgcgtgcacgaggacacgcagcgctgcttcatcacggcacagaaccacggctttgcagtg
gaggcgggcagtctgccccccggttgggcaccgctcttcaccaacgccaacgatggctcc
aatgaggggctggtgcacgagcacaaacccttcttcagtgtgcagttccaccccgagcac
cgcgctggccccacggacctggaggggctctttgatgtcttcgtggaggcggcgcgggat
ctgcagggagggaacaatgacagaacagtgcggcagcgtctgcgggatctcctggcgtac
aaggaggtgccagcagcggggcaggaggcagcacgaccccgcaaggtgctgatcctgggc
tccggcggactctccatcgggcaggcgggcgagtttgattactcagggtcacaggccatc
aaagcgctgaaagaagaaaacattcagacggtgctcatcaaccccaacatcgccacagtg
cagacctccaaggggctggcagacaaggtgtacttcctgcccatcacccctgagtatgtc
acccaggtaatccgcaacgagcgccccgacggcgtgctgctgaccttcggtgggcagaca
gccctcaactgcggcgtggagctgaccaagggcggcgtgctgcagcgataccgcgtgcgt
gtgctgggcacccccgtcgcttccatcgagatgacagaggaccgcaaggtcttcgtggag
aagatggaggagatcggcgagcacgtggcacccagcaaggccgctgcttccctggagcag
gcgcaggcggcggctgagcggttggggtacccggtgctggtgcgctcggcgtacgccctg
gggggcctgggctccggctttgcctccaaccgggaggagctggcggccctggtgagccag
gccttcacccacacctcccaggtgctggtggacaagtcgctgaagggctggaaggagatt
gagtacgaggtggtgcgcgacgcctacaacaactgcgtcacggtgtgcaacatggagaac
ctggacccgttgggcatccacacgggcgagtccatcgtggtggcacccagccagacgctc
aatgacaccgagtacttcatgctgcgccacacggccatcaaggtggtgcagcacctgggc
attgttggcgagtgcaacatccagttcgccctgaaccccgagtcggagcagtactacatc
atcgaggtgaacgcgcggctctcccgcagctcggcactggccagcaaagccacaggttac
ccgctagcctacgtggcagccaagctggcactgggcatcccgctgcctgtcctcagaaac
tccgtcaccaactccaccaccgccaacttcgagcccagcctggactactgcgtggtgaag
atcccgcgctgggacctcagcaagttcctgcgtgtcagcaccaagatcggcagctccatg
aagagcgtgggggaggtgatggccatcggcaggaacttcgaggaggccttccagaaggcg
ctgcggatggtggatgagaactgcgtgggctttgaccacacggtgaagccggcgtcggac
gtggagctggagacaccgacagacaagcgcatcttcgtgctggcggcggcgctgcgtgct
ggctattccattgagcgcctctacgagctgaccaagatcgaccgctggttcctgcacaag
atgaagaacatcacggaccacgcggcgcggctggaggcgttccgcggagagcagagcgcc
atgccgcccgccgtgctgcgccgtgccaagcagctcggcttctccgacaagcaggtggcc
ctggccgtgctcagcaccgagctggccgtgcggaagatgcggcgcgacctgggcatcctg
ccggtggtgaagcagatcgacacggtggcggccgagtggccggcgcagaccaactacctc
tacctgacctacaatggtgccgagcatgacctgcccttccgccagccccacgtcatggtc
atcggttctggtgtttaccgcatcggcagctccgtcgagttcgactggtgcgctgtcggc
tgcatccaggagctgcgcaagatgggcttcaagaccatcatggtgaattacaaccctgag
actgtgagcactgactatgacatgtgtgaccgcctctactttgatgagatctcctttgag
gtggtgatggacatctacgagctggagaaccctgagggtgtcatcctgtcaatgggcggc
cagctgcccaacaacatcgccatggcgctgcaccggcagcagtgccgcatcctgggcacc
tcccccgaggccatcgactcagctgagaaccgcttcaagttctctcgcctgctggacacc
atcggcatcagccagccactctggaaggagctctccgacatggagtcagccaagcacttc
tgctgcacggtgggctacccctgcgtggtgcggccctcctacgtgctgagtggtgctgcc
atgaacgtcgcctactcggacagtgacctggagaagtttctcagcaacgccgtggccgtg
tccaaggagcagcccgttgtcatctccaagttcatccaggaggccaaggagatcgacgtg
gatgcggtcgcctgtgacggcgtggtggtggccattgccatctctgagcacgtggagaac
gctggagtgcactcgggcgatgccacgctggtgacccccccgcaggacatcacgcccaag
actctggagcgcatcaaggccatcgtgcacgccattgggcaggagctgcaggtcaccggg
cccttcaacctgcagcttatcgccaaggatgaccagctgaaggtgatcgagtgcaacgtg
cgcgtgtcgcgctccttccctttcgtctccaagacgttgggggtggacctggtggccttg
gccagccaggtgatcatgggtgaggatgtgcagcccgtagggctgatgacgggcacgggc
atcgtcggtgtcaaggtgccgcagttctccttctcacggctggcgggtgctgacgttgtg
ctgggtgtggagatgacgagcacgggtgaggtggcctgctttggggagaaccgctgcgag
gcgtacctcaaggccatgctcagcaccggcttcaagatccccaagaagaacatcctactg
accatcggcagctacaagaacaagagcgagctgctgcccaccgtgcggaccctggagagc
cttggctacaatctgtatgccagccttggcactgctgacttctacaccgagcacggcatc
aaggtgatggcagtggattggcactttgaggaggcagacagcactgaagcgggtgcccgt
gagacgcagcgcagcatcctggactacttggcagagaaccactttgagatggtcatcaac
ctctccatgcgcaactctgggggccgccggctttcctcctttgtcaccaaggggtaccgc
acgcggcgcctggccgtcgactactccgtgcctctcatcattgacatcaagtgcaccaag
ctcttcgtggaggcactgggccagattggggccgccccgccactcaagatgcacgtggac
tgcatgacatcccagaagctgatccgcctgccagggctgatcgatgtccacgtgcacctg
cgtgagccaggtgccacacacaaggaggacttctcctcgggcactgcagccgccctggcc
gggggtgtcaccatggtgtgtgccatgcccaacaccagccccgccatcaccgacgctgca
tccttcgccctggcacagaagctggccgaggccggggcgcgctgtgacttcgccctgttc
ctgggtgcatcggcggagaacgtgggctcactgggtgcactggctgcggcagcggcaggg
ctgaagctgtacctcaacgacaccttctccagcctgcgcatggatgacgtgtcgctgtgg
atggaacacttccagcagtggccacggcatttgcccatcgtggcccacgcggaggggcag
acggtggctgccgtcctgatggtggcacagttgcaccagcgccccgtgcacatctgccac
gtggcacgcagggaggagatcctcctcatcaaggcggccaagcagaaggggatcccggtg
acgtgcgaggtggccccacaccacctcttcctgtgccaagatgacctggggcgccttggg
gagggctgtgggaccgtgcgcccagcactgggcacctcccaggacctggaggccctctgg
gagaacatggacaccatcgactgctttgccactgaccacgccccccacacactggaggag
aagcggggccccaagccgccccctggcttccctgggctggagaccatgctgcctctgctg
ctgaccgccgtctctgaggggcggctgacggtggaggatatcatcctgcgcctctacgag
aacccccgcaagatctttggactgccggcacaggaggacacctacgtggaggtggacttg
gagcaagagtgggtcatccctgagcgcactgcattctccaaggcgcaatggacgcccttt
gagggcaggaatgtgaaggggacagtgcgcagggtggtgctgcgtggggaggtcgcctac
atcgatgggcaggtcctggtgccccccggctacgggcaggatgtgaggaagtggcccatg
ggagctgtgctggcaccgctcgtggcccccaccaaggagattgtgaagacccccgagcgg
ccccggcacgcagcggtgggtgagacgctgcgcagccgagcctccagcccgcgccgcgcc
ggccccgtgcccgagggccgcttccacctcccgccccgcatccaccgtgcctctgaccct
ggtctgccagcgttccggaggctgggagccgcgcaccgcccgggcgcccgaggcaccgct
gaggacacgcgggagaaggctggcaggagggcggcagaggcagatgcgacggccgctcag
gacagccacccccacctgtcgggccccttcccacgccaggcgtccccccaaggcgtgccc
cacttccccacctcaccgctgctgcaccccctggtcgggcagcacatcctctctgtgcga
cagttctccaaggagcagatgtcccatctcttcaacgtggcgcacaccctgcgcatgctg
gtgcagaaggagcgcagtttggacatcctcaagggcaaagtgatggcatccatgttctac
gaggcaagcacgcgcaccagcagctcctttgcggccgccatgtgccggctgggcggctcc
gtggtgtcgttctgcgaggccacctcctcggtgcagaagggcgagtcgctggctgactcc
gtgcagaccatgtgctgctacgccgacgtcctggtgctgcggcacccccagcctggagct
gtggagctggccgccacgcactgccgcaagcccgtgatcaatgctggtgacggggtgggc
gagcacccgacgcaggcactgctggacatcttcaccatccgcgaggagctgggcactgtc
aacggcatgacgatcaccatggtgggcgacctgaagcacgggcgcacggtgcactcgctg
gcccgcctgctcacgcagtaccgcgtccacctgcgctacgtcacgccccgcggcctcggc
atgccgcccgacatcgccgccttcgtggcttccaagggcatctcgcaggaggagtttggg
agcatcgaggaggcgctgcccgacaccgacgtgctctatatgacccgcatccagcgggag
cgattcgagagtgctgaggagtacgaggcctgcttcgggcagttcatcctcacaccgcac
atcatgacgagggccaaggagaagatggtggtgatgcaccccatgccccgcgtcaacgag
atcagcgtggaggtggactcggacccgcgcgccgcgtacttccggcaggcagagcagggc
atgtacgtgcggatggcgctgctggctaccgtgctgggtcgctactga

DBGET integrated database retrieval system