KEGG   Gallus gallus (chicken): 428665
Entry
428665            CDS       T01006                                 

Gene name
IL17F
Definition
(RefSeq) interleukin-17F
  KO
K05494  interleukin 17F
Organism
gga  Gallus gallus (chicken)
Pathway
gga04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    428665 (IL17F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    428665 (IL17F)
Cytokines and growth factors [BR:gga04052]
 Cytokines
  Interleukins
   428665 (IL17F)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 428665
NCBI-ProteinID: XP_426223
CGNC: 53428
Ensembl: ENSGALG00000016677
UniProt: F1NFI4
Position
3
AA seq 169 aa
MAFASCAAVFRSLLLVLVLTLTVWSSPHGKVVRPRPRKDGGSEKLSEDCLNQKDPSFPTM
VKVDIRIGSSDPASRMIHDIRNRSLAPWNYRLDEDPNRFPQVIADAECRLLGCLNSLGQE
DRSLNSVPITQEILVLRREQRGCQPTYHLEKKLITVGCTCAAPVIQHQS
NT seq 510 nt   +upstreamnt  +downstreamnt
atggcttttgctagctgtgctgcagtgttcaggtctctgcttttggtgctggttttaaca
ctcactgtatggagctcaccccatgggaaggtagttcgtcctcggcccaggaaggatggt
ggctctgagaagcttagtgaagactgcctgaaccaaaaggatcccagcttccctacaatg
gtgaaagttgacattcgcattggcagctctgaccctgcctctaggatgatccacgacatc
aggaatcggtctctcgctccttggaattacaggctcgatgaggaccccaaccgcttcccc
caggtgattgctgatgccgagtgccgcctcttgggctgcttgaactcactggggcaagag
gaccgcagcctcaattccgtccccatcacacaggagatcctcgtcctccggagagagcag
aggggctgccagcccacctaccacctggagaagaagctcatcacagtgggctgcacgtgt
gctgctccggtcatccagcaccagtcctag

DBGET integrated database retrieval system