KEGG   Gallus gallus (chicken): 428701
Entry
428701            CDS       T01006                                 

Gene name
NONO
Definition
(RefSeq) non-POU domain-containing octamer-binding protein
  KO
K13214  non-POU domain-containing octamer-binding protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gga03041]
    428701 (NONO)
Spliceosome [BR:gga03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    428701 (NONO)
SSDB
Motif
Pfam: RRM_1 NOPS RRM_7 RRM_occluded RRM_5
Other DBs
NCBI-GeneID: 428701
NCBI-ProteinID: NP_001026703
CGNC: 4102
Ensembl: ENSGALG00000005507
UniProt: Q5ZIZ5
Position
4
AA seq 473 aa
MQGNKGFNMEKQNHAPRKQHQHQHQQHPPPSIPANGQQANSQKQLCTLFPSDEGLTIDLK
NFRKPGEKTFTQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRT
LAEIAKVELDNMPLRGKQLRVRFACHSASLTVRNLPQFVSNELLEEAFSVFGQVERAVVI
VDDRGRSSGKGIVEFSGKPAARKALDRCSDGSFLLTTFPRPVTVEPMDQYDDEEGLPEKL
VIKNQQYHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQQQEQVDRNIKEAREKLEMEM
EAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLEIRQEEERRRREEEMRRQQE
EMMRRQQEGFKGNFADAREPPDMRMGQMGMGGTIGMNNRGAMGGTNVPAAAPPAAGPGAM
IPDGAMGMTPPPPADRFGQGSAMEGLGAMGGNPPAFNRGNPGGEFGPNKRRRY
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgcagggcaacaagggcttcaacatggagaaacagaaccacgcgccgcggaagcagcac
cagcaccaacaccagcagcacccgccgccctccatccccgccaacgggcagcaggccaac
agccagaagcagctgtgtaccttattcccctcagatgaaggcctgaccatcgacctgaag
aatttccggaaacctggggaaaaaaccttcacccaaagaagccgcctctttgtggggaat
ctgcccccagatattacagaggaagagatgagaaagttgtttgagaagtatggcaaggca
ggtgaagtcttcatacacaaggacaaaggctttggctttatcaggctggaaactcgcact
ctggcagagattgcaaaagtggaactagacaacatgcctctccgtgggaagcagctcaga
gtgcgttttgcgtgccacagcgcatcgctgacagtcaggaacctgcctcagttcgtgtcc
aatgagctcctggaggaagccttctcggtgtttggccaggtggaaagggctgtggtgatt
gtggatgacagagggcgatcctctggaaaaggcattgtggagttctcagggaagcctgct
gctaggaaagccctggacagatgtagcgatggctctttcctgctgacgacattccctcgg
cctgtgactgtggagcccatggatcaatatgatgatgaagagggactaccagaaaaactt
gtcatcaaaaaccagcaatatcacaaggagcgtgagcaacctcctcgatttgcacagcct
ggcagctttgagtatgagtatgccatgcgttggaaggctctaatagaaatggagaagcag
cagcaagaacaggtagaccgtaacatcaaggaagctcgagagaagctggaaatggaaatg
gaagcagctcgccatgagcaccaagttatgctcatgaggcaagatttaatgagacgccag
gaagaactgaggaggatggaggaattgcataaccaggaagtacaaaaacgtaaacagttg
gaaatcaggcaagaggaagaacgcaggcgccgtgaggaagaaatgagaaggcagcaggaa
gagatgatgagacgccagcaggaaggcttcaaggggaactttgctgatgcgagggagcca
ccggacatgcgaatgggacagatgggtatgggaggtaccattggcatgaacaatagagga
gctatgggtggtaccaacgtccctgctgctgcgcctcctgcagctggtcctggagctatg
atacccgatggagccatgggaatgactccaccaccgcctgcggatcgctttgggcagggc
agcgcgatggaaggcctgggagcgatgggagggaaccctcctgccttcaacagaggaaat
ccagggggtgaatttggccctaacaaacgtcgcagatactaa

DBGET integrated database retrieval system