KEGG   Gallus gallus (chicken): 428708Help
Entry
428708            CDS       T01006                                 

Gene name
AGTR2
Definition
(RefSeq) type-2 angiotensin II receptor
  KO
K04167  angiotensin II receptor type 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04080  Neuroactive ligand-receptor interaction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    428708 (AGTR2)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    428708 (AGTR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    428708 (AGTR2)
G protein-coupled receptors [BR:gga04030]
 Class A. Rhodopsin family
  Cardiovascular peptide
   Angiotensin
    428708 (AGTR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv Piezo_RRas_bdg
Motif
Other DBs
NCBI-GeneID: 428708
NCBI-ProteinID: XP_004940717
CGNC: 4436
Ensembl: ENSGALG00000005936
UniProt: F1NC23
Position
4
AA seq 372 aa AA seqDB search
MQSNYSMGITTRETLQILYTAQANSSAVLRSPPPCPLTSSSYQFSLIPAFFSVVFALGLV
GNSVVVVVLCHRSSPRTVANIYIFNLAMADLLCLATLPFWATYYAQGYNWIFGSLMCKIS
SSVLCLNMFASIFFITCMSVDRYHAIVHPIRSQRRTPHQAYFIALVVWGLACLSSLPTFY
FRDTHYIKSMEVKACIMAFPHESYAEWSVGTAFLKNALGFFIPLAVITTCYVWIRRHLIQ
AQEFGKNKQKRDRVLKLVAAVVVAFLICWLPFHILTFLDALAHMNIIDNCDVTGVIDTAL
PFGICMAFANSCVNPLVYCFIGNQFQEKLHRLFKRRVYQFNSQRESSSLRKGSCFRDTEI
AVGREREPESPL
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcaactactccatgggcatcaccaccagggaaaccctccagatcctctataca
gcacaggcaaactcatcggctgtgttacgctcgccgcctccctgcccgctgacctcttcc
agttatcagttttcattaattccagcattcttctctgtggtttttgctctgggtttggtt
ggcaatagcgtggtggttgtggtgctctgtcatcgcagtagccccagaacagttgctaat
atctacattttcaacttggctatggcagatctgctgtgccttgccacccttcccttttgg
gctacctattatgcacaggggtacaactggatctttggatctctcatgtgtaaaatctcc
agctctgtcctgtgtctgaacatgtttgcaagcatatttttcatcacatgcatgagcgtg
gacaggtaccatgcaattgtccaccctatccgctcccaaagaagaactccgcatcaggcg
tattttatagcactggttgtgtggggacttgcctgtttgtcctccctcccaactttttat
ttccgtgacacacactacatcaaaagcatggaagtgaaagcttgcatcatggcatttcct
cacgagagttatgcggagtggtctgtgggaacagccttcctgaaaaatgcacttggcttc
ttcatccccttggcagtgatcaccacgtgctatgtctggatcaggaggcacctgatacaa
gcacaggagtttggcaaaaacaagcagaagagggacagagtcctaaagctggtggctgct
gttgttgtggccttcttaatttgctggctcccattccacattttgacgtttttggatgcc
ctggctcatatgaacatcattgacaactgtgatgtgacaggggtcatcgacacagcactg
ccatttggcatctgcatggcttttgccaacagctgcgtcaaccctttggtgtactgcttt
attgggaaccagttccaggagaagctccatcgcttgtttaagcgacgagtttaccagttc
aacagccaacgagagagctcttctttgaggaaagggagctgcttccgagacactgagata
gcagtgggcagggagagggagcccgagtccccgttgtga

DBGET integrated database retrieval system