KEGG   Gallus gallus (chicken): 428716
Entry
428716            CDS       T01006                                 

Gene name
SLC16A2
Definition
(RefSeq) monocarboxylate transporter 8
  KO
K08231  MFS transporter, MCT family, solute carrier family 16 (monocarboxylic acid transporters), member 2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gga02000]
    428716 (SLC16A2)
Transporters [BR:gga02000]
 Solute carrier family (SLC)
  SLC16: Monocarboxylate transporter
   428716 (SLC16A2)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Monocarboxylate transporter (MCT) family [TC:2.A.1.13]
    428716 (SLC16A2)
SSDB
Motif
Pfam: MFS_1 TM140
Other DBs
NCBI-GeneID: 428716
NCBI-ProteinID: NP_001308666
CGNC: 5859
Ensembl: ENSGALG00000007748
UniProt: A0A142EGP9
Position
4
AA seq 509 aa
MWDRLRGSRAAGGGRSAAAMAQRGEEGGERGPAEEGGEGEPRAGAERGPSGAAAPFQPPE
GGFGWVVVFAAAWCNGSIFGIHNSFGIIYTMLQSDLGEDEKDPTLEFKTAWVGSLAMGMI
FFCSPIVSIFTDRIGCRTTAALGAAIAFIGLLSSSFTKSLEVRYFTYGILFGCGSSFAFQ
PSLVILGHYFKRRLGLANGIVAGSSCLISVPLPFFLKMVGKAIGLAHTFQVLSALMLIQI
FLSMTYRPLLPPSCDSQHDGQDKLGSRSVRQQCWAQMRKYFNLRVFRRKTYRIWAFGIAT
AVLGYFVPYMHLVKYVEKEFGETKNDWILPVCLGGMSGLGRLISGRTGDCIPGLKKIYLQ
VASFVLFGIMCMMIPQCRGFEGVIVICLFLGLCDGCFTTIMAPVAFELVGPMQASQAIGY
LMGLMAVPMTAGTPIAGYFNDYFQNYHAGFYFAGVPPIIGGLVLSVVPLVHQRMLQKQRL
DSGKDKMLTPEAVVNGELLPGCPASEAHM
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgtgggaccggctgcggggcagtcgggcggcgggcggcggccggagcgcggccgcgatg
gcgcagcgcggggaggagggcggcgagcgggggccggcggaggagggcggggagggagag
ccccgggccggggccgagcgggggccgagcggggccgccgcgcccttccagcctcccgag
ggcggcttcggctgggtcgtggtcttcgccgccgcctggtgcaatggctccatcttcggc
atccacaactccttcgggatcatctacaccatgttgcagagcgacctgggcgaggacgag
aaggaccccacgctggagtttaaaacagcatgggttggctctttggccatgggcatgatt
ttcttctgctctcccatcgtgagcatcttcactgaccgcatcggctgcaggaccacagca
gccttgggagctgccatcgctttcatcgggctcctctccagctccttcaccaagtctctg
gaagttcgctatttcacgtatggcatcctctttggctgtggcagctcctttgcctttcag
ccctcgctggtcatccttggtcactacttcaagcgtcgccttggcctggccaatggcatc
gtggctggcagcagctgcctcatctctgtgccgctgcccttcttcctgaagatggtggga
aaggccatcgggctggcacacacattccaagtgctcagtgccttaatgctcatccagatc
ttcttgtcgatgacatatcggcccctcctgccaccctcctgtgactctcagcacgatggg
caggacaaactgggcagccggagtgtgcggcagcagtgctgggcccagatgcgcaagtat
ttcaacttgagggttttccggagaaagacctaccgaatttgggcctttgggattgctaca
gctgtcctggggtattttgtaccatacatgcacctggtgaaatatgtggagaaggaattt
ggagaaaccaaaaacgactggattctcccagtctgtcttggaggcatgtctgggctgggg
cgcttgatttcgggccgcactggggactgcattcctgggctgaagaagatttatctgcag
gtcgcgtcctttgttctgttcggcatcatgtgcatgatgatcccgcagtgccgagggttt
gagggcgtcatcgtcatctgcctcttcctcggcctttgcgatggctgcttcaccaccatt
atggcccccgttgcctttgagctggtggggcctatgcaagcatcccaggccatagggtac
ctgatggggctgatggctgtgcccatgactgcgggcacgccaattgcaggatacttcaac
gattattttcagaattaccatgcgggtttttacttcgccggagtgcctcccatcatcggc
ggcttggtgctctccgtcgtcccgctggtgcaccagaggatgctgcagaagcagcgcctg
gattctggcaaggacaagatgctgacccctgaggcagtggtgaatggcgagctgctgcca
ggctgccctgcctccgaagcacacatgtga

DBGET integrated database retrieval system