KEGG   Gallus gallus (chicken): 428753Help
Entry
428753            CDS       T01006                                 

Gene name
PRKG2
Definition
(RefSeq) cGMP-dependent protein kinase 2 isoform X1
  KO
K19477  cGMP-dependent protein kinase 2 [EC:2.7.11.12]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04540  Gap junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    428753 (PRKG2)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     428753 (PRKG2)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: AGC group
  PKG family
   428753 (PRKG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase cNMP_binding Pkinase_Tyr Kinase-like IncA PKcGMP_CC ATG16 Corona_S2 APH Lge1
Motif
Other DBs
NCBI-GeneID: 428753
NCBI-ProteinID: XP_004941152
CGNC: 8290
Ensembl: ENSGALG00000010909
Position
4
AA seq 777 aa AA seqDB search
MGNASMKHKHLRQPDRHVANLALGCASHYKFLTDPGLGIHVTGQVDVLCSRVLELEKELK
RKDEELQEGQSLVAELQEQLSVQTKVIAELTKELQSKCIQLNKLQDVINTQGEHSLQPSP
FRVTPKNQISADRRKGAKEGVSAEPTTQLYDSSKQARFSFEKSRVRKDSSEKKLITDALN
KNQFLKRLEPQQIREMVECMYERTFQQGSYVIRQGEPGNHIFVLKEGRLEVFQQNKLLSS
IPVWTAFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRVTAQTRQEQYRNFLRSV
SLLKNLPEDKLTKIMDCLEVEYYNKGDYVIREGEEGNTFFIIAKGKVKVTQSTADHSQPQ
LIKNLHKGDYFGEKALISDDVRSANVIADEYDVECLVIDRDTFNQTVGTYEELQTYLEGY
VANLARADEKRHAKRRSFCGQSTKEVSLEMIQLKEKVAQFPSSPFQNLEVVTTLGVGGFG
RVELVKVKNENVAFAMKCIKKKHVVDTKQQEHIYSEKKILEQICSPFIVKLYRTFKDSKY
VYMLLEACLGGELWSLLRDRGCFDEPTTKFCVGCVTEALDYLHHIGIVYRDLKPENLILD
AEGYIKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILSKGHDFSVDFWSLGILVYELLT
GSPPFSGADQMTTYNLILKGIEKLDFPRTITRRPEDLIRRLCRQNPTERLGNLRNGINDI
KKHRWLNGFNWDGLKLRKLASPLKRELSGPTDYSYFDSYPPEEGMPPDELSGWDKDF
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atggggaatgcatcaatgaaacacaaacacctgaggcagccagacagacacgtagcaaac
ctagctcttggttgtgctagccactataagtttctaacggaccctggtctgggcatccat
gtgactggacaagttgatgtgctttgcagcagggtgcttgaactggaaaaggagctgaaa
agaaaagatgaagagttgcaagagggtcaaagtcttgttgctgagcttcaggagcagctg
tctgtgcagactaaggtcatcgcagaactcaccaaggaacttcagagcaagtgcatacag
ctgaacaagctgcaggatgttattaacactcaaggagaacactctcttcagccttctcca
tttagagtgactccaaagaatcaaatctctgctgacaggaggaaaggagctaaggagggt
gtatctgcagagccaacaacacagctctatgattccagcaaacaagctagattttccttt
gaaaaatcaagggtccgaaaggattccagtgagaaaaagctcatcacggatgccctgaat
aaaaatcagtttttgaagagactggaacctcagcagatccgagagatggtggaatgtatg
tacgagaggactttccagcaggggagctatgtcatcagacaaggagagccaggcaatcac
atttttgtcctcaaagagggcagactggaagtcttccagcagaataaactgctctcctcc
atacctgtgtggacagcgtttggtgaactggccattttatacaactgcacgcggacggct
tccgtgaaagcaatcaccaatgttaaaacatgggcactggacagagaagtgtttcaaaac
atcatgagagtgacagcacagacaagacaagaacagtacagaaactttcttagaagtgtg
tccctcttaaaaaacttgccagaagataaactgaccaaaatcatggactgcctggaggtg
gagtactataacaaaggagattatgttattcgggaaggagaagagggaaataccttcttt
ataatagcaaaaggaaaggtaaaggttacccagagtactgcagatcactcacagcctcag
ctgattaaaaatctgcataaaggagattactttggagaaaaggccctcattagtgatgat
gtcagatcagcaaatgttattgcggatgaatatgacgtggagtgcctcgttatagataga
gacacatttaatcaaactgttggaacttatgaggagttacaaacctaccttgagggttat
gtggctaatctggcccgggctgatgaaaagcgacatgccaaaagaagatccttctgtgga
cagtcaaccaaagaggtgtctttggaaatgatacagctgaaggagaaagtagcccagttc
ccttcttccccattccagaatttagaagttgtcacaactctcggtgttggtgggttcgga
agggttgaacttgttaaggtaaaaaatgagaatgtggcttttgctatgaagtgtataaag
aagaaacatgtagtggacaccaaacaacaagagcatatatattctgaaaagaaaatcctt
gagcagatatgttctcctttcattgtgaaactgtatcgcacattcaaggatagtaagtat
gtgtacatgctgctggaggcttgccttggtggggagttgtggagcttgctgagagacaga
ggctgctttgatgaacccactacaaagttctgtgttggctgtgtgacagaggctttggac
tatctacatcacataggaattgtctacagagacttgaagccagaaaacttaattttggat
gctgaagggtatataaaattggttgattttggatttgcaaaaaagatcggatcagggcag
aaaacctggacgttctgtggaacccctgagtatgttgctccagaagtcattctgagtaag
ggccatgacttcagtgtggatttttggtcccttgggattcttgtgtatgaactccttact
ggcagtccaccgttctctggggctgatcagatgacaacctataatttgattctaaaaggc
attgaaaagctggattttccgagaacaataacaaggcggcctgaggatttgatccgcaga
ctctgcaggcagaacccaacagaaagattaggcaatctgaggaatggaattaatgacatt
aagaagcacaggtggttgaatggttttaactgggatggtctgaaactgaggaaattagca
tcacctttaaaaagagagttgtctggaccaactgattacagctactttgacagctatcca
cctgaagagggaatgcctccagacgaactttctggctgggacaaggatttctga

DBGET integrated database retrieval system