KEGG   Gallus gallus (chicken): 428813
Entry
428813            CDS       T01006                                 

Gene name
ALDH3B1L2
Definition
(RefSeq) aldehyde dehydrogenase family 3 member B1
  KO
K00129  aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00010  Glycolysis / Gluconeogenesis
gga00340  Histidine metabolism
gga00350  Tyrosine metabolism
gga00360  Phenylalanine metabolism
gga00410  beta-Alanine metabolism
gga00980  Metabolism of xenobiotics by cytochrome P450
gga00982  Drug metabolism - cytochrome P450
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    428813 (ALDH3B1L2)
  09105 Amino acid metabolism
   00340 Histidine metabolism
    428813 (ALDH3B1L2)
   00350 Tyrosine metabolism
    428813 (ALDH3B1L2)
   00360 Phenylalanine metabolism
    428813 (ALDH3B1L2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    428813 (ALDH3B1L2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    428813 (ALDH3B1L2)
   00982 Drug metabolism - cytochrome P450
    428813 (ALDH3B1L2)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.5  aldehyde dehydrogenase [NAD(P)+]
     428813 (ALDH3B1L2)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 428813
NCBI-ProteinID: XP_426371
CGNC: 53472
Ensembl: ENSGALG00000036044
UniProt: A0A1D5P553
Position
5
AA seq 496 aa
MEQPLEHPWQPTDGEAGTAGGDDGGMSENPYAGLVSRLRAAWLSRRTRPLEYRVAQLEAL
GRFLEEKKQDILEATALDMRKPPFEAEFSEVLLCKNELNEALNNLSRWMKDKHVDKNLAT
QLDSAFIRKDPYGVVLIIGPWNYPIYLLLVPLIGAIAAGNCVIIKPSELTKNSEKLMEEV
LPKYLDKDCFAVVTAGVEETTRLLENKFDYIFFTGSPSVGRIIMTAAAKHLTPVTLELGG
KNPCYVSDTCDVQNVARRVVWGRFFNAGQTCIAPEYVLCSVEMQEKLIPALREAITEFYG
SEPRNSPDFGRIVGDKQFRRVQALLSSGRVAIGGQTDEKERYIAPTVLVDVKPSDPAMQE
EIFGPILIIITVANIDEAIDFINSRERPLVVYAFSSNSKEVNQVLERTSSGGFCGNDTLM
HVTLTSLPFGGIGSSGLGMYHGQFTFDTFTHHRGCLQRSTGLEPINTLRYPPYSTHKMDL
VRTATSVKRRGECFLL
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggagcagccccttgagcacccctggcagcccacggatggtgaggctggcacagccggt
ggggatgatggtggcatgagtgagaacccctatgcggggctggtgagccgcctgcgggca
gcctggctctcacggaggacacggcccttggagtaccgcgtggcacagctggaggccctg
ggccgcttcttggaggagaagaagcaggacatcctggaggccaccgccttggacatgcgc
aagccaccttttgaggccgagttctctgaggtccttttgtgcaagaatgagctcaatgaa
gccctgaacaacctgtcccggtggatgaaggacaagcatgtggacaagaacctggcaacg
cagctggactcagccttcatccgcaaggacccctatggggtagtgctcatcattgggccc
tggaactaccccatctacctcctcctggtgcccctcattggggccattgctgctggtaac
tgcgtcatcatcaagccctcagagctgaccaagaacagcgagaaactcatggaggaagtg
ctgcccaaatacctggacaaagactgctttgctgtggtgactgctggtgtggaggagacc
accaggctgctggagaacaagtttgactacatcttcttcaccggcagcccctcagtgggc
aggatcataatgacggctgctgccaagcacctgacaccggtgacgctggagctggggggc
aagaacccctgctacgtgtccgacacctgcgacgtgcagaacgtggcccggcgggtggtc
tgggggcgcttcttcaacgcggggcagacctgcatcgcacccgaatatgtcctgtgcagc
gtggagatgcaggagaagttgatacctgccctgcgtgaggccatcacagagttctatggc
tctgagccccgcaattcccctgactttggccgcatcgtgggggacaaacagttcaggcgt
gtgcaggcgctgctgagcagcgggcgtgtggccatcgggggacagacggacgagaaggag
cgctacattgcccctacggtgctggtggatgtgaagccctctgaccctgccatgcaggag
gagatctttggccctatcctgatcatcatcacagtggccaatatagatgaagccattgac
ttcatcaacagtcgtgaacggcctctggttgtgtatgccttctcctccaacagcaaggag
gtaaaccaagtgctggagaggacgagcagcgggggcttctgtggcaacgacaccctgatg
cacgtgacgctgacctcgctgcccttcggtggtatcgggtccagcggtctggggatgtac
cacggccagttcacctttgacaccttcacccaccaccgtggctgcctgcagcgcagcacc
ggcctggagcccatcaacaccctgcgctaccccccctacagcacccacaagatggatctg
gtccgcactgccacctcagttaagcgccggggggaatgcttcctcctctga

DBGET integrated database retrieval system