KEGG   Gallus gallus (chicken): 428820
Entry
428820            CDS       T01006                                 

Gene name
COR8
Definition
(RefSeq) LOW QUALITY PROTEIN: olfactory receptor-like protein COR8
  KO
K04257  olfactory receptor
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    428820 (COR8)
G protein-coupled receptors [BR:gga04030]
 Others
  Chemoreception
   Olfactory
    428820 (COR8)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx DUF4293
Other DBs
NCBI-GeneID: 428820
NCBI-ProteinID: XP_015141580
CGNC: 53477
Ensembl: ENSGALG00000031583
Position
5
AA seq 317 aa
MAEGNSTVVSQFVLLGLTGEPELQTPLFIVLSVIYLITLLGNVGLITLITTSPRLHTPMY
FFLCNLSVVDLCYSSVFSPRLLIGFLLDNKTISYSACFTQHFFFLVFVTTEVFLLAVMAY
DRYVAICNPLLYTISMPKSLCMKLVAGSYLGGVLNSLTQTCCLLPLPFCGPNVINHYXCD
TNPLLKLTCSDGRLNELLLVTFNGTISMTVLLLIIISYVYILVSILSIRSARGRHKAFST
CASHLLTVTLFYVPAGLSHMQPGSKYSLDMEKVTAVFYTLLVPMLNPLIYSLRNKEVKDT
LRRARERIFSQAAHCVL
NT seq 954 nt   +upstreamnt  +downstreamnt
atggctgaaggcaacagcacggtggtgagtcagttcgtcctcctaggactgacaggtgag
cctgagctgcagactcctctcttcatagtgctctcagtgatttatctcatcaccctgctg
ggtaacgttgggctgatcacactgatcacgacaagcccccgtctgcacactcccatgtac
ttctttctctgcaatctatctgttgttgatctttgctactcctctgtcttttctccaagg
ctgcttattggcttcttgctggataataaaaccatttcctactctgcttgcttcacccag
catttctttttccttgtgtttgtgaccacagaggtgttcttgctggccgtgatggcatac
gaccgctatgtagctatttgcaaccccttgctctacactatttccatgcccaagagtctc
tgcatgaagctggtggctggctcgtacctggggggcgttctgaactcactaacccagaca
tgctgcttgctgcccttgccgttctgtggccccaatgtcatcaaccattatntctgtgac
accaaccctctgctgaaactcacctgctctgacggacgcctcaatgagctcctgctcgtc
accttcaatgggaccatttccatgactgtgctcctcctcatcatcatctcctatgtgtac
atcctcgtctccatcctgagcatcaggtctgccaggggacggcacaaagccttctccacc
tgtgcctcccacctgctgactgtcaccttgttctacgtgcctgctggcctcagccacatg
cagccaggctccaagtactcactggacatggagaaggtcacggcagtgttttacaccttg
cttgttcctatgctcaaccctctgatctacagcttgaggaataaggaagtcaaggacaca
ctcaggagagcaagagagagaatattctctcaagctgctcactgcgtactctga

DBGET integrated database retrieval system