KEGG   Gallus gallus (chicken): 428832Help
Entry
428832            CDS       T01006                                 

Gene name
CYP1C1
Definition
(RefSeq) cytochrome P450, family 1, subfamily C, polypeptide 1
  KO
K17812  cytochrome P450 family 1 subfamily C
Organism
gga  Gallus gallus (chicken)
Brite
Cytochrome P450 [BR:gga00199]
 Cytochrome P450, animal type
  CYP1 family
   428832 (CYP1C1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 428832
NCBI-ProteinID: NP_001296383
CGNC: 53487
Ensembl: ENSGALG00000040754
UniProt: A0A1D5PQJ7
Position
5
AA seq 516 aa AA seqDB search
MSAMGTPNGAAMAPVLSPHSALLLIAVVLTAILLLARTRHKATRGQSPPGPFASPLVGNV
LQMGRLPHLTFMRMACRYGAIFQLRLGRHRVVVLNGEAAIRRALVGLGTRFAGRPDFPSF
GLVSGGRSIAFGGCTPQWRARRRLAHAALRAHSTVAEVERHVVAEAGDLVRLFLRHSQGG
AYFQPCPLLVVANANVLCALCFGRRYDHADGEFTALLGRNDRFGQTVGAGSLVDVLPWLL
RFPNPVRHVYRDFQALNRELHGFVQAKVAQHRQTFDWRAVRDISDVMIASVERGGGSPDG
LGPEDVEGAMTDIFGAGQDTTSTALSWIILLLLKHPQVQQDLQAELDRVVGRSRLPTAED
RPHLPLLEAFIYETLRYSSFVPITIPHATTADVELEGFRIPKGTVVFVNQWSVNHDCSKW
PEPQRFDPTRFLDKQQRLDRERAGSVMIFSAGQRRCIGDQLSKLQIFLFTAILLHQCSFH
ANPAEHLTMDCIHGLALKPLPFTVNVRPRIPLLIQP
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgatggggacccccaacggggcggccatggcgccggtgctgtcgcctcactct
gcccttcttctcattgccgtcgtgctcactgccatcctgctgctcgccaggactcgccac
aaggccactcgtggccagagcccgccgggtcctttcgcgtcgcctctggtgggcaacgtc
ctgcagatgggccgcctgccccacctcaccttcatgcgcatggcgtgccgctatggagcc
atcttccagctgcgcctgggccggcaccgggtggtggtgctcaatggcgaggcggccatc
cggcgggcgctggtggggctgggcacgcgcttcgccggccggcctgacttcccttccttc
gggctggtgtcaggtgggcgcagcatcgcctttgggggctgcacgccccaatggcgggca
cggcggcggctggcccacgctgccctaagggctcattcaacggtggctgaggtggagcgg
cacgtggtggccgaggcgggtgacctggtgcggctcttcctgaggcacagccagggtggt
gcttacttccagccctgcccgctcttagtggtggccaacgccaatgtcctctgcgctctc
tgctttggccgccgctatgaccacgctgacggcgagttcaccgcgttgcttggccgcaat
gaccgctttgggcagacggtgggggctggcagtctggtagatgtactgccctggctcctg
cgcttccccaaccccgtccgtcatgtctaccgtgacttccaggccctcaaccgggagctg
cacggctttgtgcaggccaaggtggcacagcaccgccagacctttgactggcgggcagtc
cgtgacatcagtgatgtcatgatcgcctctgtagagcgtggtggtgggtcccctgatggg
ctgggacctgaggacgtggaaggtgccatgaccgacatctttggtgcggggcaggacacc
acgtccacggcgctctcatggatcatcctgctgctgctgaagcacccgcaggtccagcag
gaccttcaggctgagctggatcgggtggtgggacgcagccggctgcccacagctgaggac
cgaccccatctgccccttctggaggccttcatctacgagacgctgcgctacagcagcttt
gtgcccatcaccattccacatgccaccacggctgatgtggagctcgagggcttccgcatc
cctaagggcactgtggtctttgtcaaccagtggtcagtcaaccacgactgcagcaagtgg
cccgagccacagcgcttcgaccccacgcgattcctggacaagcagcagcgcctggaccgt
gagcgggccggaagcgtgatgatcttctcggctggccagcggcgctgcattggtgaccag
ctctccaagctccagatcttcctcttcaccgccatcctccttcaccagtgctccttccac
gccaacccagcggagcacctcaccatggactgcatccatgggctggcgctgaagccactg
cctttcaccgtcaacgtgcggccgaggatccccctgctcatccagccatga

DBGET integrated database retrieval system