KEGG   Gallus gallus (chicken): 428888
Entry
428888            CDS       T01006                                 

Gene name
LTBP2
Definition
(RefSeq) latent-transforming growth factor beta-binding protein 2 isoform X1
  KO
K08023  latent transforming growth factor beta binding protein 2/3/4
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:gga04990]
    428888 (LTBP2)
Domain-containing proteins not elsewhere classified [BR:gga04990]
 EGF-like domain-containing proteins
  hEGF / cEGF domain-containing proteins
   428888 (LTBP2)
SSDB
Motif
Pfam: EGF_CA cEGF TB EGF FXa_inhibition EGF_3 hEGF
Other DBs
NCBI-GeneID: 428888
NCBI-ProteinID: XP_015143162
CGNC: 53503
Ensembl: ENSGALG00000010258
Position
5
AA seq 1851 aa
MSASKRRKRGRFPKIKPSIPSRLWQCQRRAQRCSEPPAERQSSPAGRPLSSRSSSFGGAA
RQPPARSPAPAGSRCWRSPAGRWGSEARLRRADRSAAPGGMPAPRRRPSPAPRADSMRGA
AASVLPLTFAILLGLGDCQRDLAARLEPGASRRADPRRLRGQTAPLGATGTAPGLPRPHR
APPEPAALPAALRPERGPAESPNDGRRQRPEPGLGPAQGLQPSRQRPRSALKARVAPRAK
EPNGRGRMAGPNVCGRQCCSGWAVAPGTNHCIKPVCDPPCQNKGSCSRPHVCTCRSGFQG
SRCEEVVPEQEYHPPSIALQPPAGSLRRRTGTAERDASPREAQAPVPRHAPTRTQSRIGS
PVSTQHTGPSRTVRRYPASNGQLTSNTLPNGHGHEQGSSGPNAAFQEHTLAARGANLTEK
IRKIKIIFTPTICKQTCRNGRCYNSCEKGDTTTLYSQGGHDHDPKSGFRIYFCQIPCLNG
GRCVGRDECWCPSNSTGKFCHLPAPSPEKKQGGKAPNTVASGSMKHSTYTLPLSNQLASL
NPSLVNVHINHPPEATVQIHQVARVRGDSEVSEENSVEAVLVPQMAAVPWYTYSNGNGNS
IATEGGQQQRPPGLLGRCFREALHGQCTNPLPGLTLLEDCCGSVGLFWGVDRCLACPPRP
AHPVIENGQVECPQGYKRLNRSHCQDINECLMQGLCKDAKCLNTRGSFRCTCRPGTMLDP
SRSHCISDKAVSMEQGLCYRSAAGGVCSFPLSHRITQQICCCSRVGKGWGKNCEECPVPG
SGAFKEICPAGHGYTYSSSDIRLSMRKAEAEELPLSLEEHSESSNWTLDWAARRQRLQDS
LHGSVLEALPHPDISAGEGEVFPAGQDAADITPEPEAHRVEEEETRRAPPQPGPTTTWAD
AAPTQIPAQGSEASGCASSSLACGAGVCVLTPDGYSCSCHLGYTLHPSRLHCVDEDECLQ
DPCTGKGHCVNSVGSYSCLCYSGYTLVFLESKQTCQDRDECEQPSTCPGQRCVNTPGSYR
CECKEGFAMGLRGQCEDINECVDPSPCPHGKCVNTPGSYRCVGCADGYQPRNGRCIDVDE
CLVERTCAHGQCINLDGSFRCSCYRGYEVAPDGKSCEDIDECTAQAACPSRLCLNTEGSY
SCMACDAGYTVSRDGSTCEDVDECADLAIQCLGGACRNTLGSYECHCQAGFELINGTVCQ
DVNECLNSEICSPNGECLNSHGSYFCICAPGFSSSDGGVNCQDVDECTDKSRCSQGQCLN
TEGSYRCLCENGFKHSQETDDCIDVDECKEYGDAICGTWRCQNSLGSYRCIMGCQPGFHW
TPPGDCIDIDECANETLCGSHGFCENSDGSFRCLCDRGYESSPSGHYCVDVNECELMVAV
CGTALCENVEGSFLCLCPSDHEEYDTEAGQCRPRAAVEGPERHTAQPSDSMERKQCYYHI
SDVRLCDSVLAKNVTKQECCCTVGAAWGDNCETYPCPILGTVEYQEICPLGKGYVPQEDP
LSGKVSFTDMDECETFGSEFCRNGQCLNTVPGYKCFCRTGYFYDVGRLECVDQDECQNEV
YCINGECLNTVGSYHCFCSLPLVLDATGNRCVNLSGRADALEEYEIHLDVCWQTVSDYIC
QDLLHGEQTTYTECCCRLGEAWGQNCALCPHRSSADFAFLCNGASEDSDRGAEVRERPRY
EYGPGLEDPHYGLPSPDMGPYYNYLESEYGNPDVAFPRRELSSEFRGSPFHHGPGRPPPR
YLPSQPGLYEGFEGLQAEECGILNGCENGRCVRVPEGYTCDCFDGYQLDMTLMACVDINE
CEDVDVPVPLCQGGTCENTEGSYRCRCLPGYVALAQPHHCVPQTAQSPAAA
NT seq 5556 nt   +upstreamnt  +downstreamnt
atgtcagcatcaaaaagacgcaaaagggggaggtttccaaaaataaaaccctccatcccc
tccaggctctggcagtgccagaggcgggcgcaaaggtgctcggagccgcccgcggaacgc
cagagctcgccggcgggacggccgctctcctcccgctcttcgtccttcggcggggccgct
cggcagcccccggcccggtccccggccccggcgggcagcaggtgctggcggagccccgcg
gggagatggggcagtgaggcgcggctccgtcgggcggaccggagcgcagcccccgggggg
atgcccgccccgcgccgccgtccctcgcccgccccgcgggctgacagcatgcggggcgcc
gcggccagcgtcttgcccctcaccttcgcgatcctgctgggactcggcgactgccagcgg
gacctggcggcgaggctggagcccggcgcctcccgccgcgccgatccccgccggctgcgg
ggacagaccgcgcccctgggggcgacgggcaccgctcccggcctgccccggccgcacaga
gcccccccggagccggccgccctgcccgccgccctccgccccgagcgcggccccgcggag
agccccaacgacggccgcaggcagcgccccgagcccggactcggccccgcgcaggggctg
cagccgtcccggcagcgacccaggagcgcgctcaaggcgcgggtggcgccgcgggcgaag
gagccgaacggcagagggaggatggcggggccgaacgtctgtgggagacagtgctgctca
ggctgggctgtggctcctggcacaaaccactgcatcaaacctgtttgtgacccaccgtgc
cagaacaagggctcctgcagccggccccatgtctgtacctgtcgctcgggcttccagggc
tccaggtgtgaagaagtcgtccctgagcaagagtaccacccacccagcatcgccctgcag
ccccctgcgggctccctgcggaggaggactggcacagctgagcgggatgcctccccacga
gaggctcaggcacctgtcccacgacatgcacccaccaggactcagagcagaattggctct
cctgtctcaacccagcatacagggccgtcacgaactgtccggcgctaccccgccagcaat
ggccagctcacgtctaacacgctgcccaatgggcacgggcatgaacagggcagctctggg
ccaaatgcagctttccaggagcacacgttggctgcaaggggggcaaacctgacagagaag
attaggaaaataaaaatcatcttcacacccaccatctgcaaacagacatgccggaatggg
cgctgctacaacagctgtgagaagggagacaccaccactctctacagccaagggggacat
gaccacgaccccaagtctggcttccgcatctacttctgccagatcccctgcctgaatgga
ggacgctgtgttggccgtgatgagtgctggtgcccttccaactccacggggaagttttgc
cacttgccggccccctctccagaaaagaagcaaggagggaaggcaccaaacaccgtagcc
agtggatctatgaagcactccacgtacaccctgcccttgtccaaccagctggcttccctg
aacccttccctggtgaacgtccatatcaaccaccctccagaagccaccgtgcagattcac
caggtggccagggtgcggggtgactcagaggtgtcagaggagaacagcgtggaggcagtg
ctggtgcctcagatggccgcggtgccctggtacacctacagcaatgggaacggcaacagc
atcgccactgagggaggccaacagcagagacccccagggttgctggggaggtgctttcgg
gaagctctccatgggcagtgcaccaacccactgccagggttgaccctgctggaggactgc
tgcggcagcgtggggctcttctggggggtggacaggtgcctggcctgcccccctcggcca
gcacaccccgtcattgagaacggacaggtggagtgtccccagggatacaagaggctgaat
aggagccactgccaagatatcaacgaatgcttgatgcagggcttgtgcaaagacgccaag
tgtttgaatacccgtggcagcttccgctgtacttgcagacctggcaccatgttggacccc
tcccgcagccactgcatctctgacaaagcagtgtcgatggagcaggggctgtgttaccgc
tcagcagctggaggtgtgtgctccttccccctctcccaccgaatcactcagcagatctgc
tgctgcagccgcgtcggcaagggctggggcaagaactgtgaggaatgccctgtgcccggc
tcaggagcgttcaaggagatttgcccagcaggacacggctatacctactccagctctgac
atccgcctttccatgaggaaagcagaggcagaagagctgcccctaagcctggaagagcac
agtgagagcagcaactggacgttagactgggcagcaaggagacagcggctgcaggacagt
ttgcatgggagtgtcctggaggcattgccccaccccgacatctcagcaggagagggtgaa
gtttttcctgctgggcaggatgctgctgatatcaccccagagcctgaggcgcacagagtg
gaggaagaagagacccggcgtgctcctccccagcctggccctaccaccacctgggctgat
gctgctccaacgcagatacccgcgcagggctcagaggccagcggctgtgcttcttcatcc
cttgcctgtggagctggtgtgtgtgtgctcaccccagatggatacagctgctcatgccac
ctgggctatacgctgcaccccagtcgtctgcactgtgttgatgaagatgagtgtctgcaa
gatccttgcactggaaaaggtcactgtgtcaacagcgtgggctcctattcatgcctctgc
tactctgggtacactctggttttcttggagagcaagcagacctgtcaggatcgagatgaa
tgtgagcagccttctacatgtccgggacaacgatgtgtcaacacccccggctcctaccgt
tgcgagtgcaaggagggctttgccatgggcctccgaggacaatgtgaagatatcaatgag
tgcgtggatcccagcccttgtccccatgggaagtgtgtcaataccccgggctcctacagg
tgtgtcggctgtgcggacggctatcagcccaggaacggaagatgcatcgatgtggacgag
tgcctggtggagagaacctgtgcccatggacagtgtatcaacctggatggctctttccga
tgttcctgctaccggggctatgaggtggcacccgatgggaagagttgtgaagacattgac
gagtgcacagcccaggctgcctgtccctccagactctgcctcaacactgagggctcctac
tcctgcatggcttgtgatgctggctacaccgtttctagagatggcagcacatgtgaagat
gtggatgaatgtgcagaccttgctattcagtgcctggggggagcatgccggaacacactg
ggctcctacgagtgccactgccaggctggattcgagctcatcaatggcaccgtgtgccaa
gatgtgaatgagtgcctgaacagtgagatctgcagccccaatggtgagtgtctcaacagc
cacggatcctacttctgcatctgtgcgcctggcttctccagctcagatggaggagtcaac
tgccaagatgtggatgaatgtacagacaaatcccggtgctcacaaggccagtgcctgaac
acagaaggctcctacaggtgtctgtgtgaaaatgggttcaaacactcccaggagactgat
gactgcatagatgtggacgaatgtaaggaatatggggatgccatctgtggcacgtggcgg
tgccagaacagcctgggctcctaccgttgtatcatgggctgccagcctggcttccactgg
acacccccgggtgactgcattgacatagatgagtgcgccaatgagacgctgtgtgggagc
catggcttctgtgagaactcagatggctccttccgctgcctctgtgaccgtggctacgag
agctcaccctctgggcactactgtgttgatgtgaacgagtgtgagctaatggtggccgtg
tgtgggaccgcactctgtgagaacgtggagggatcattcctgtgcctgtgccccagcgac
catgaggagtacgacacagaggcagggcagtgtcggccacgggcagccgtggagggccct
gagagacacacagcccaaccctctgacagcatggagcgcaagcagtgctactaccacatc
agcgacgttcgcctgtgtgacagcgtcctggccaagaacgtcacgaagcaggagtgctgc
tgcaccgtgggggcagcctggggtgacaactgtgagacctacccctgccccatcttgggc
acagtggagtatcaagagatctgccctcttgggaagggctatgttcctcaagaagatcca
ctctcaggaaaagtctccttcacagacatggatgagtgcgagaccttcggctccgagttc
tgccgcaatggacagtgtctgaacacggtgccgggctacaagtgcttctgccgtacaggc
tacttctacgatgtcggcaggcttgaatgcgtagatcaggatgagtgccagaacgaggtg
tactgcatcaacggcgagtgcctgaacacagtcggctcctaccactgcttctgcagcctc
ccgcttgtgctggatgccactggcaaccgctgcgtgaacctctctggcagggcagatgcc
ctggaggagtatgagatccacctggatgtctgctggcaaactgtctctgactacatctgc
caagacctgctgcacggcgagcagaccacctacactgagtgctgctgccgccttggcgaa
gcctggggccagaattgtgcgctctgtccacacaggtcctctgctgattttgctttcctc
tgtaatggagccagtgaagacagtgacagaggggctgaggtccgagaaagacctaggtat
gaatacggaccaggcttggaagatccccactatggccttcccagcccagacatgggcccc
tactacaactacctggagtcagagtatggaaaccctgatgtggctttccctcggagagaa
ctgagcagtgagtttcgtggcagccctttccaccatggcccagggcggcccccaccccgc
tacctgcccagccaacccggtctttacgagggctttgaagggctgcaggctgaggagtgt
ggcattctcaatggctgtgagaacggacgttgcgtgcgcgtcccagagggctacacctgt
gactgcttcgatggctaccagctggacatgaccctcatggcctgtgtggacatcaatgag
tgcgaggacgtggatgtcccagtgcccctgtgccagggcggcacctgcgagaacacagaa
ggctcctaccgctgccgctgcttaccaggctatgtggcactggcccagccccaccactgc
gtgccccagacagcccagagcccggcagcagcatag

DBGET integrated database retrieval system