KEGG   Gallus gallus (chicken): 428911
Entry
428911            CDS       T01006                                 

Gene name
RCOR1
Definition
(RefSeq) REST corepressor 1 isoform X1
  KO
K11829  REST corepressor 1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Myb_DNA-binding ELM2 Myb_DNA-bind_7 Myb_DNA-bind_6 Homeobox_KN
Other DBs
NCBI-GeneID: 428911
NCBI-ProteinID: XP_015143302
CGNC: 8652
Ensembl: ENSGALG00000011384
UniProt: E1BWG6
Position
5
AA seq 449 aa
MPAMIEKGPEVSGKRRGRNNNTSAGANHNNNGNNKSLAAAPNGNSSSNSWEEGSSGSSSD
EEHAGGGMRVGPQYQAVVPEFDPAKLARRSQERENLGMLVWSPNQNLSEAKLDEYIAIAK
EKHGYNMEQALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKTFHRI
QQMLPDKSIASLVKFYYSWKKTRTKTSVMDRHARKQKREREESEDEMEEANGNNPIDIEV
EQNKESKKEVPPAETLPQVKKEKHSTQAKNRAKRKPPKGMFLSQEDVEAVSANATAATTV
LRQLDMELVSIKRQIQNIKQTNSALKEKLEGGIEQYRLPEVVQKFNARWTTDEQLLAVQA
IRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAEHGKEETNGTNSQKP
VKSPDNSTKMSEEEDEATSVLDVRYASAS
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgccagccatgatcgagaagggcccggaggtgtcggggaagcggcggggcaggaataac
aatacctccgccggcgcgaatcataacaataacgggaataacaaaagtttggccgctgcc
cccaacgggaacagcagcagcaactcctgggaggagggcagctcgggctcctccagcgat
gaagagcacgccggcggcggcatgagggtcggcccgcagtaccaggcggtggtccccgag
ttcgaccccgccaaacttgccagacgaagtcaggagagagagaacctcggcatgctggtc
tggtcgcctaatcagaatctctctgaagcaaaattggacgaatatattgccattgctaaa
gagaagcatggatacaatatggagcaggctcttgggatgctgttttggcacaagcacaac
attgagaaatctttggcggatctgccaaacttcactccattcccagatgagtggacagtg
gaagacaaggtcctgtttgaacaggctttcagtttccacgggaaaacctttcacaggatc
cagcagatgcttcctgacaaatcaatagccagcctggtgaaattttactactcctggaag
aagacaaggactaaaactagcgtgatggaccgtcatgctcgtaaacaaaaaagggaacgt
gaggaaagtgaggatgaaatggaggaagcaaatggaaataaccctattgatattgaagtt
gaacaaaacaaggagagcaaaaaggaggtgcctcccgctgaaactcttcctcaggtgaag
aaggagaagcacagtacacaggccaagaacagagcgaagaggaaacctcccaagggaatg
ttcctttctcaagaagacgtggaggccgtttctgccaatgccacagctgctaccactgta
ctcagacaactggacatggaattagtctcaatcaagcgacagattcaaaatatcaaacag
acaaacagcgctctcaaagaaaaacttgaaggtgggatagaacagtacagacttccggag
gttgttcagaaatttaatgcacgttggaccacagatgagcagcttcttgctgtgcaagca
atcaggaaatacggacgagactttcaggcaatctctgatgtgatcggtaacaaatctgtg
gtgcaagtgaaaaacttttttgtaaattaccgacgtcgtttcaacatagatgaagttcta
caggagtgggaggcagaacacggcaaagaggagacaaatggaaccaatagccagaagcct
gtaaaatcccccgataattccactaaaatgtctgaagaggaagatgaggctacttctgtt
cttgatgtcagatatgcatctgcttcgtga

DBGET integrated database retrieval system