KEGG   Gallus gallus (chicken): 428925Help
Entry
428925            CDS       T01006                                 

Gene name
MGAT2
Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00510  N-Glycan biosynthesis
gga01100  Metabolic pathways
Module
gga_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    428925 (MGAT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gga01003]
    428925 (MGAT2)
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     428925 (MGAT2)
Glycosyltransferases [BR:gga01003]
 Glycan extension
  N-Glycan
   428925 (MGAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2 Gp45_2
Motif
Other DBs
NCBI-GeneID: 428925
NCBI-ProteinID: XP_015132222
CGNC: 53512
Ensembl: ENSGALG00000031212
Position
5
AA seq 442 aa AA seqDB search
MRLRIYKRKVLLLALALAACALVLWGGGGTGGRRRQQQPQQRGGTGEPPRVSEAPRRPAG
AGNASASASAAAPTAGAENGTLSYRSLVYRLNFDQPLRNAGRFPARPGGPDVVLVVQVHD
RAEHLRLLLESLRRAPGVENALLVLSHDLWADELNRLAAAVDFCPVLQVFFPFSVQLYPR
EFPGHDPRDCPRDVGKAAALRLGCLNAEFPDSFGHYREARFSQTKHHWWWKLHFVWERVR
ALREHAGPVVFLEEDHYLAPDFYHVLKRLWALRQRDCPECQVVSLGSYAVGRGGFAGRAD
KAEVKTWKSTEHNMGMAFGRDTYQKLIECTDAFCTYDDYNWDWTLQHLTVSCLPKFWKVL
VPEIPRVFHTGDCGMHHKKSCRPSSQSAKIDSLLSSNRQYLFPETMSVSKRYSMAPLSPH
VKNGGWGDIRDHELCKSYRRLQ
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgcggatctacaagcggaaggtgctgctgctggcgctggcgctggcggcctgc
gcgctggtgctgtggggaggcggggggacgggcgggcggcggaggcagcagcagccgcag
cagcggggcggcaccggagagccgccgcgggtcagcgaagcgccgcgccgccccgccggc
gccggcaacgcctcggcctcggcctccgccgccgccccgaccgccggcgcggagaacggg
acgctgagctaccgctcgctcgtctaccgcctcaacttcgaccagccgctgcgcaacgcg
gggcgcttcccggcccggcccggcggccccgacgtggtgctggtggtgcaggtgcacgac
cgcgccgagcacctgcggctgctgctcgagtccctgcggcgcgcgccgggcgtggagaac
gcgctgctggtgctgagccacgacctgtgggccgacgagctgaaccggctggcggccgcc
gtggacttctgcccggtgctgcaggtcttcttccccttcagcgtccagctgtacccccgc
gagttccccgggcacgacccccgcgactgcccccgcgacgtgggcaaagcggcggcgctg
cgcctgggctgcctcaacgccgagttccccgactcgttcgggcactaccgcgaggcgcgc
ttctcgcagaccaaacaccactggtggtggaagctgcacttcgtctgggagcgcgtgcgg
gcgctgcgggagcacgccgggcccgtcgtcttcctggaggaggaccactacctggcgccc
gacttctaccacgtcctcaagcggctgtgggcgctgcggcagcgcgactgccccgagtgc
caggtggtctcgctgggctcctacgcggtgggccgcgggggcttcgccggccgcgccgat
aaggccgaggtgaagacgtggaagtccacggagcacaacatgggcatggccttcggcaga
gacacctaccagaagctcatcgagtgcacggacgccttctgcacgtacgatgactacaac
tgggactggacgctgcagcacttgactgtgtcgtgtcttccaaagttctggaaggtgctg
gtccccgaaatcccccgcgtctttcacacgggagactgcggcatgcaccacaagaagtcc
tgcaggccgtcctcccagagtgccaaaatcgactctctgctgagcagcaaccggcagtac
ctgttccccgagacgatgagcgtcagcaaaaggtactccatggcccccctgtccccccac
gtcaagaacggaggctggggggacatccgggaccacgaactctgtaagagttaccgccgc
ctccagtga

DBGET integrated database retrieval system