KEGG   Gallus gallus (chicken): 428996
Entry
428996            CDS       T01006                                 

Gene name
LRRFIP1
Definition
(RefSeq) leucine-rich repeat flightless-interacting protein 1 isoform X1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: LRRFIP DUF3322 Tweety
Other DBs
NCBI-GeneID: 428996
NCBI-ProteinID: XP_004942528
CGNC: 2830
Position
7
AA seq 1203 aa
MGTQGAGRKRLPNRERLTAEDDALNQIAREAEARLAAKRAARAEAREIRMKELERQQKEI
YQVQKKYYGLDTKWGDIEQWMEDSERYSRRARRNASASDEDERMSVGSRGSLRSHVEYAG
AYPVAGLENERTKWKNYSKATNGYEEDMYGSSQSRKSSRASYYPDLGLPNSGYASTSQPS
SQNGNWASVYDESVYSGSRRYSASSSRAPSEYSCYLGSGSRASSRASSARASPVIEERPE
KDFEKGARTVSSLSAATLASLGGTSSRRGSGDTSISADTEASIREIKDIYELKEQIQDVE
GKYMQGLKEMKDSLAEVEEKYKKAMVSNAQLDNEKTNFMYQVDTLKDALLELEEQLAESR
RQYEEKSKEFEREKHAHSILQFQFKEIKEALKQREEMLAEIQQLQQKQQSYVREISDLQE
TIEWKDKKIGALERQKDFFDSIRSERDDLRDEVIMLKEQLKKHGIIPDSDIATNGEASDV
LDNEGHLDSSKTVQGTTQALKTAGDGMLGKANEVDMKNEILEDVGKREILQNSEREEHKE
ESEEQEVQTLHADENTKAEKMIEETDGLSTVMLPDSRFTEQIPSLTEPMSGNASSNDGSD
GDGLRMETESADTAAQQPVSKEAEHGNLNPRTTENSEVGSLQGQDFESPQETHGDSDAEH
ELVKAAPQQEGEDVEASHALSANEVEQAADSAHDSSEMVSVQSGLPDPVLAGSLSEEVNG
EGHAETLQCLEESAENKVTEVLEKTLVESKDCTGGTADKTGGDRAGEQNEVGSAVQGQKM
ERDSTGLEGEESCESGAPSDPNEEGGDQAHIQPVSSEVGELVLLEEQNTQEQTELKPAEK
DGQEEVLIGNLEACSDPAEKQEKASESVGSANEVEGNVLHQTEPDMDSVKEMAAQETSLD
PVSDDEIEETEMQTGDVSGKGEGNRIEDLEHNTTEDLKPKAELQTVQCSEETTGDTEDEK
NTSLESEAQNVDKQEEGESKEESIVCHSVMSESQVDKEALKENKKESEPADHQGDGFTSV
EDADSSLALKAELDENVSEQLKLEGQAEEEQEDDGDAFDFDEDSEQTAETDEKCDGEEVD
AQSEEDDRTNSVIRKTAQTGEAGEGSGKIETSDTLTEDDSLQHKEGNESEETELSQEEAS
ALETDEKADVLADEDKASDPNEVEKEPGEQDLESAGCSRAESKEDLRGGRKGKGKSKDDC
TMS
NT seq 3612 nt   +upstreamnt  +downstreamnt
atggggacgcagggagcgggcaggaagcggctgccgaaccgggaacgcctgacggcggag
gacgacgcgctcaaccagatcgcccgtgaggctgaagcgaggctggcggcaaagcgagca
gcacgggcagaggcacgggagatccggatgaaggaactcgaacggcagcagaaagagatc
tatcaagttcagaagaaatattatggtctggatactaaatggggcgacatcgagcaatgg
atggaagacagtgagcgctattcacgtagagcccgaagaaatgcctcggcttcggatgaa
gatgagcgcatgtcagtgggtagccgtggaagcctgaggtctcatgtggagtatgccggc
gcctatccagtggctggattagagaatgagaggaccaaatggaagaactactccaaagca
accaatggttatgaggaagacatgtatggatcgtcccagagtagaaaatctagcagggct
tcatactaccctgatctgggtcttcccaacagtggctatgcttccacatctcagccttct
tcccaaaatggaaactgggcgtctgtgtatgacgagagtgtttacagcgggagtcgtcgg
tatagtgcctctagttctcgtgctccttcagagtacagctgctacctcggttcgggatct
cgggcatcctcaagagccagctctgctcgggccagtccagtgattgaggagcggccagag
aaagattttgagaagggagcacgtactgtctcaagtctatcagcagctaccttagcttcc
ttgggtgggacttcttcacgaagaggcagtggggatacgtccatctcagcagatacagag
gcatctattagagaaataaaggatatctatgagttaaaggagcagattcaagatgtagaa
ggcaaatacatgcagggactgaaagaaatgaaggactctctagctgaagttgaagagaaa
tacaaaaaggctatggtgtcaaatgctcaactagacaacgaaaaaacaaatttcatgtac
caagtagataccctgaaggatgcactcttagagttggaggaacagcttgcagaatccagg
aggcaatatgaagaaaagagtaaagaatttgagagagagaagcatgctcatagcatattg
cagtttcaatttaaggaaatcaaagaggctttgaagcaaagagaagaaatgcttgcagaa
atccaacagctgcaacagaaacagcagagctatgtcagggaaatttctgatcttcaggag
acaatagagtggaaagacaaaaaaataggggccttagagaggcagaaagatttctttgat
tccataaggagtgagcgggatgaccttagagatgaagtgattatgctgaaggagcaactg
aagaaacatggaataatcccagactctgacatagccaccaatggggaggcatcagacgtt
cttgataatgaaggacacttggattcttccaaaactgttcaaggcacaacacaggcatta
aagacagcgggggatgggatgctaggcaaagccaatgaagtggacatgaaaaatgagatt
ttggaggatgtggggaaaagagaaatcttgcagaattctgagcgtgaggaacacaaagag
gagtctgaggaacaggaagtacagacattgcatgctgatgaaaatacaaaggcagaaaaa
atgattgaagaaactgatggtctgtcaacagtgatgttaccagatagtaggtttacagaa
caaatcccaagccttacagaacctatgtcagggaatgcttcttcaaatgatggtagtgat
ggagatggtttgagaatggagacagagtcagcagacacagcagcccagcagcctgttagc
aaggaggccgaacacggtaacttaaacccaaggacaactgagaactcagaagtgggctca
ctgcaaggccaggattttgagagtcctcaggaaacgcacggtgactcagatgcagagcat
gaactggtaaaggctgctccacaacaggaaggagaggatgtggaagctagccatgcactg
agtgctaatgaggtggagcaagcagcagacagtgcacatgacagcagtgagatggtttct
gtccagtcagggctaccagaccccgtgctagcaggctcacttagtgaagaggtaaatggg
gagggccatgctgaaacactccagtgcttggaagaaagtgctgaaaacaaagttacagag
gtcttggagaaaacccttgttgaaagcaaagactgcactggtggaacagctgataaaact
ggaggtgatagagctggagaacaaaacgaggttgggagtgcagttcagggtcagaaaatg
gaaagagattccacgggcttagaaggggaggagtcatgtgaaagtggtgccccatcagat
ccaaatgaagagggaggagatcaggcacacatccagccagtttcctcagaggttggtgag
ttagtgttattagaggaacagaatacgcaggagcaaacagaacttaaacctgctgagaaa
gacggacaggaggaagtattgattggaaacttggaggcgtgttcagatcccgcagaaaag
caggagaaggcatctgagtctgtgggctctgctaatgaggtagaaggaaatgtactgcat
cagacagagccagacatggactctgtgaaagaaatggcagctcaggaaaccagtttagac
ccagtttcagatgatgaaattgaggaaacagaaatgcaaacaggagacgtgtctgggaaa
ggagagggaaacagaatagaagacttagagcacaatacaacagaagacttaaaaccaaag
gcagagcttcaaacagttcagtgcagtgaagaaacaacaggtgacacagaggatgagaaa
aatacttctttagaaagtgaagcacagaatgtagataaacaagaagaaggtgaatctaaa
gaggagtccattgtatgtcacagtgtaatgagtgagagccaagttgataaagaagcgctt
aaagaaaataaaaaagagtcagagcctgcagaccaccagggtgatggatttacttctgtg
gaagatgcagatagttctctcgcactgaaagctgagctggatgaaaatgttagtgagcaa
cttaaactagagggccaagcagaggaagaacaagaagatgatggtgatgcatttgatttt
gatgaggattcagaacagacagcggaaactgatgaaaaatgtgatggagaagaagttgat
gcgcagagtgaagaggatgacagaacaaacagcgtgatcagaaaaactgcccaaacaggt
gaagctggagagggaagtggcaaaatagaaaccagtgacaccttgactgaagatgacagc
ttacagcataaggaaggaaatgagtctgaagaaacagagctctcacaagaggaagcatca
gcattggaaactgacgagaaggctgatgtgttggcagatgaagacaaagcatcagatcct
aatgaagtggaaaaggaaccaggtgaacaggatttggaaagtgctggctgtagcagggct
gaaagcaaagaggatttgcgaggtggtaggaagggtaagggtaaatctaaagatgactgt
acaatgtcctaa

DBGET integrated database retrieval system