KEGG   Gallus gallus (chicken): 428997
Entry
428997            CDS       T01006                                 

Symbol
ACKR3
Name
(RefSeq) atypical chemokine receptor 3
  KO
K04304  C-X-C chemokine receptor type 7 (atypical chemokine receptor 3)
Organism
gga  Gallus gallus (chicken)
Pathway
gga04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    428997 (ACKR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    428997 (ACKR3)
   04050 Cytokine receptors [BR:gga04050]
    428997 (ACKR3)
G protein-coupled receptors [BR:gga04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    428997 (ACKR3)
Cytokine receptors [BR:gga04050]
 Chemokine receptors
  CXC Chemokine
   428997 (ACKR3)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 428997
NCBI-ProteinID: NP_001076831
CGNC: 14408
Ensembl: ENSGALG00000021031
UniProt: A1KXM6
Position
7:complement(5066250..5071645)
AA seq 364 aa
MSALDLTSIVDFLEKANLTEINWMCNNSDCITVDATTCPGTLNKSALLYTLSFFCIFIFV
IGLVANSVVVWVNLQAKMTGYETHLYIFNLAVADLCVVITLPVWVVSLVQHNQWHMGEIT
CKITHLIFSINLYGSIFFLACMSVDRYLSVAYFTNSSNRKKKIVRRCICILVWLLAFSAS
LPDTYFLKTVSTSNETYCRPAYPEESFKEWLIGMELISVVLGFLIPFPVIALFYFLLAKT
ISASSDQERKSSGKIIFSYVVVFLVCWLPYHTTVLLDIFYSLHFIPFSCQMENFLYATLH
ITQCFSLVHCCVNPILYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSEAEYSALE
QNTK
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgagtgcgcttgatttgacttcaatcgttgattttctggaaaaggccaacttaacggag
atcaactggatgtgcaacaacagcgactgcatcacagtagatgcgacgacatgccctggc
acgctcaacaaaagtgccctgctctacaccctgtccttcttctgcatctttatctttgtc
atagggctggtggccaactctgttgtggtgtgggtcaatctccaagccaaaatgactggc
tatgaaacccatctctacatcttcaatttggctgtcgccgatctgtgtgttgtcatcacg
cttcctgtttgggttgtctccctcgtccagcataaccaatggcacatgggagaaatcacg
tgcaaaataactcaccttatattttcgatcaacttgtacggcagcatcttcttcctggca
tgcatgagcgtggaccgctacctctcagttgcctatttcactaattctagtaaccgcaag
aagaagatcgtccgccgctgcatctgcatcctggtgtggcttcttgccttttctgcatct
ctgccagacacctatttccttaagacagtctctaccagcaacgagacctactgccgcccc
gcgtatcccgaggagagcttcaaagagtggttgattggcatggagctcatctctgtcgtt
ttgggcttccttatcccttttccagtcattgctctcttttacttcctccttgcgaagacc
atctctgcctccagcgaccaagagaggaagagcagcgggaagatcatcttctcctatgtc
gtggtgtttcttgtctgctggctaccctaccatacaactgtccttctcgacatcttctac
agccttcatttcatacccttcagttgtcaaatggagaacttcttgtacgccacgcttcac
atcactcagtgtttctctctagtccattgctgtgtcaaccccatcctctatagcttcatt
aatcgcaattacagatacgagctcatgaaagcctttattttcaagtactctgccaaaact
ggtctcactaagcttattgatgcttccagagtgtcagaagcagaatactctgctctggag
caaaataccaaatga

DBGET integrated database retrieval system