KEGG   Gallus gallus (chicken): 429011Help
Entry
429011            CDS       T01006                                 

Gene name
KLF7
Definition
(RefSeq) Krueppel-like factor 7
  KO
K09207  krueppel-like factor 6/7
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    429011 (KLF7)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    429011 (KLF7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 DUF3850 zf-C2H2_8
Motif
Other DBs
NCBI-GeneID: 429011
NCBI-ProteinID: NP_001305919
CGNC: 6448
Ensembl: ENSGALG00000008501
UniProt: I3QKS3
Position
7
AA seq 296 aa AA seqDB search
MDVLTSYSIFQELQLVHDTGYFSALPSLEENWQQTCLELERYLQTEPRKISESFGEDLDC
FLHASSAPDAEDSIRRLDPILLPVETSMCDKGANMDIILSRDKLLSETCLSLQSTSSSTE
SYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKSSLGSMKVSV
AAATAGTIKSGQSDSEQGGPGLEASPENKKRVHRCQFNGCRKVYTKSSHLKAHQRTHTGE
KPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCNHCDRCFSRSDHLALHMKRHI
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcctgaccagttatagtatattccaggaactgcagcttgtccacgacaccggc
tacttctcagctttgccatccttggaggagaactggcagcagacatgcctcgagttggag
cgataccttcagactgaaccgcggaagatctctgagagcttcggtgaggacttggactgc
ttccttcatgcctcctcagctccagatgcagaggacagtatccgacggctggaccccatc
cttttgccagtggagacgagtatgtgcgacaaaggcgccaacatggacattatcctctca
cgggacaagctgctgtctgagacgtgcctcagcctgcagtccaccagctcttccacagaa
agctacacggccgtcaaccaggcccaactcaatgcagtaacctcattaacacccccttcc
tctccggagctcagccgccacctcgtaaaaacctcacagactctctcggcggtggatggc
acagtgactttgaaattggtggccaagaaatcttctctcggctccatgaaagtgagtgta
gcggcagcaaccgcggggacgataaagagcgggcaaagtgacagtgaacaaggaggaccg
ggactggaagcatctccagaaaacaagaagagggttcaccgctgtcagtttaatgggtgc
cggaaggtttatacaaagagctcccacttaaaggctcaccagaggactcacacaggtgag
aagccttacaagtgctcgtgggaagggtgcgagtggcgttttgcacggagcgacgagctc
acaaggcattacagaaagcacacgggtgcaaagccctttaaatgcaaccattgtgacagg
tgtttttccaggtctgatcaccttgccctccacatgaagaggcacatctaa

DBGET integrated database retrieval system