KEGG   Gallus gallus (chicken): 429035Help
Entry
429035            CDS       T01006                                 

Gene name
TUBA1C
Definition
(RefSeq) tubulin alpha-1 chain
  KO
K07374  tubulin alpha
Organism
gga  Gallus gallus (chicken)
Pathway
gga04145  Phagosome
gga04210  Apoptosis
gga04530  Tight junction
gga04540  Gap junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    429035 (TUBA1C)
  09143 Cell growth and death
   04210 Apoptosis
    429035 (TUBA1C)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    429035 (TUBA1C)
   04540 Gap junction
    429035 (TUBA1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    429035 (TUBA1C)
   03036 Chromosome and associated proteins [BR:gga03036]
    429035 (TUBA1C)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    429035 (TUBA1C)
   04147 Exosome [BR:gga04147]
    429035 (TUBA1C)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     429035 (TUBA1C)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     429035 (TUBA1C)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    429035 (TUBA1C)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   429035 (TUBA1C)
  Exosomal proteins of other body fluids (saliva and urine)
   429035 (TUBA1C)
  Exosomal proteins of colorectal cancer cells
   429035 (TUBA1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Motif
Other DBs
NCBI-GeneID: 429035
NCBI-ProteinID: NP_001292201
CGNC: 53544
Ensembl: ENSGALG00000037953
AA seq 451 aa AA seqDB search
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD
RIRKQADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGVDSVEGEGEEEGEEY
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagtgcatctccatccacgtgggccaagcgggcgtgcagatcggcaatgcgtgc
tgggagctgtactgcctggagcacggcatccagcccgacgggcagatgcccagcgacaaa
accatcggcgggggggacgactccttcaacaccttcttcagcgagacgggggccggcaag
cacgtgccccgtgccgtctttgtggacctggagcccaccgtgatcgatgaggtgcgcacg
gggacgtaccggcagctcttccaccccgagcagctgatcacgggcaaggaggatgcggcc
aacaactacgcccgggggcactacaccatcggcaaggagatcatcgacctggtgctggac
cgcatccgcaagcaggctgaccagtgcacggggctgcagggcttcctggtgttccacagc
ttcgggggcggcaccggctccggcttcacctcgctgctgatggagcgcctgtcggtggac
tacggcaagaagtccaagctggagttctccatctacccggccccgcaggtgtccacggcc
gtggtggagccctacaactccatcctcaccacccacaccacgctggagcactccgactgc
gccttcatggtggacaacgaggccatctacgacatctgtcgcaggaacctggacatcgag
cgccccacctacaccaacctcaacaggctgatagggcagatcgtgtcctccatcacagcc
tcactgcgcttcgatggggctctgaacgtcgacctgacggagttccagaccaacctggtg
ccctaccctcgcatccacttcccattggccacgtatgcgccggtgatctctgctgagaag
gcctaccacgagcagctgtcggtggctgagatcaccaacgcgtgcttcgagccggccaac
cagatggtgaagtgcgacccgcggcacggcaagtacatggcgtgctgcctgctgtaccgc
ggggacgtggtgcccaaagatgtcaacgccgccatcgccaccatcaagaccaagcgcacc
attcagttcgtagactggtgcccaactggtttcaaggtgggcatcaactaccagcctccc
accgtggtgcccgggggggacctggccaaggtgcagcgcgccgtgtgcatgctgagcaac
accacggccatcgccgaggcgtgggcgcgcctggaccacaagtttgacctgatgtacgcc
aagcgcgccttcgtgcactggtatgtgggggagggcatggaggagggggagttctcggag
gctcgggaggatatggctgccctggagaaggattacgaggaggtgggggtggattcggtg
gagggtgagggtgaggaggaaggagaggagtactga

DBGET integrated database retrieval system