KEGG   Gallus gallus (chicken): 429110Help
Entry
429110            CDS       T01006                                 

Gene name
PRKAA2
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-2
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04068  FoxO signaling pathway
gga04140  Autophagy - animal
gga04150  mTOR signaling pathway
gga04371  Apelin signaling pathway
gga04530  Tight junction
gga04910  Insulin signaling pathway
gga04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    429110 (PRKAA2)
   04068 FoxO signaling pathway
    429110 (PRKAA2)
   04150 mTOR signaling pathway
    429110 (PRKAA2)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    429110 (PRKAA2)
  Cellular community - eukaryotes
   04530 Tight junction
    429110 (PRKAA2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    429110 (PRKAA2)
   04920 Adipocytokine signaling pathway
    429110 (PRKAA2)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     429110 (PRKAA2)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   429110 (PRKAA2)
Membrane trafficking [BR:gga04131]
 Autophagy
  Other autophagy associated proteins
   Others
    429110 (PRKAA2)
Mitochondrial biogenesis [BR:gga03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    429110 (PRKAA2)
  Mitophagy factors
   Other mitophagy factors
    429110 (PRKAA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 Kdo APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 429110
NCBI-ProteinID: NP_001034694
CGNC: 8225
Ensembl: ENSGALG00000010826
UniProt: Q2LAI0
Position
8
AA seq 552 aa AA seqDB search
MAEKQQKHDGRVKIGHYVLGDTLGVGTFGKVKVGEHQLTGHKVAVKILNRQKIRSLDVVG
KIKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEAEARRL
FQQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNY
AAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNR
SVATLLMHMLQVDPLKRATIKDIREHEWFKEELPSYLFPEDPSYDATVIDDDAVREVCEK
FECTESEVMNSLYSGDPQDQLAVAYHLVIDNRRIMNQASEFYLASSPPTGSFMDDTMHIP
PGVKPHPERMPPLIADSPKARCPLDALNTTKPKPLTVKKAKWHLGIRSQSKPYDIMAEVY
RAMKQLDFEWKVVNSYHLRVRRKNPVTGNYVKMSLQLYQVDNRSYLLDFKSIDDEVMEQR
SGSSTPQRSCSAAGLHRPRLSIDAAAAAECQSLMGSLSGSFVGSISSVPPRLGSHTMDFF
EMCASLIMALAR
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaagcagcagaagcacgacgggagggtgaagatcggccactacgtgctgggg
gatacgctgggggtcggcaccttcggcaaagtcaaggttggcgaacatcagctgacgggg
cacaaagtagcagtaaaaatcctaaacagacagaaaatacgcagcctggatgtggttggg
aagatcaaaagagaaattcaaaacctgaaactcttccggcaccctcatattatcaaactg
taccaggtcatcagcacgccaacagacttcttcatggtcatggaatacgtatctggcggt
gaattatttgattacatctgtaagcatggacgtgttgaagaggcagaggctcgacgcctt
ttccagcagattctctccgcggtggattactgtcaccgacacatggttgtccacagggac
ctgaaaccagagaacgtgctgctggatgcacacatgaatgcgaagatagctgattttgga
ttgtccaacatgatgtctgatggtgaatttctacgcaccagctgcggttccccaaattat
gcagcccctgaagtcatctctggaaggctgtatgctggcccagaggtggacatctggagc
tgcggtgtcatcctctatgccctcctctgtggcactttgccctttgatgatgagcatgtg
cccaccctcttcaagaagatccggggaggcgtgttttacatccctgagtacctcaaccgc
tccgttgccactctgctcatgcacatgctgcaggttgaccctctcaagcgtgcaaccatc
aaggacatcagggaacatgagtggtttaaggaggagctgcccagctacctcttcccagag
gacccttcctacgatgccaccgtcatcgatgatgacgcggttcgggaggtctgtgagaag
tttgagtgcaccgagtcagaagtgatgaacagtctgtacagcggcgacccccaggaccaa
ctagcggtcgcctaccaccttgtcattgacaaccggaggatcatgaaccaagccagcgag
ttctacctagcctccagccccccaactggctccttcatggacgacaccatgcatatccct
cccggtgtgaagccgcaccctgagcggatgccacccttgatagcagacagtcccaaggca
cgctgccctttggatgcactcaacaccaccaagcccaaacctctgactgtcaaaaaggcc
aagtggcacctggggatccgcagccagagcaagccctatgacattatggccgaggtgtac
cgagctatgaaacagttggattttgaatggaaggtggtgaactcctaccacctcagagtg
cgtcggaagaacccggtgacgggcaattacgtgaaaatgagtctgcaactgtaccaggtg
gacaaccgcagctacctcctggacttcaaaagcattgatgacgaggtgatggagcagagg
tccggctcatccaccccgcagcgctcgtgctcagccgctggcttgcaccggccaagacta
agcattgatgctgcagcagccgctgagtgccagtcactgatggggtccctgagtggctcc
ttcgtgggcagcatctcctcagtgcccccacgcctgggcagccacaccatggacttcttc
gagatgtgtgccagcctgatcatggctctggctcgctga

DBGET integrated database retrieval system