KEGG   Gallus gallus (chicken): 429269
Entry
429269            CDS       T01006                                 

Symbol
MKNK2
Name
(RefSeq) MAP kinase-interacting serine/threonine-protein kinase 2
  KO
K04372  MAP kinase interacting serine/threonine kinase [EC:2.7.11.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    429269 (MKNK2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    429269 (MKNK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    429269 (MKNK2)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     429269 (MKNK2)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   429269 (MKNK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo zf-RRN7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 429269
NCBI-ProteinID: XP_015155359
CGNC: 2815
Ensembl: ENSGALG00000003845
Position
28
AA seq 467 aa
MVQKKSELAGFHRSFTGQNPFELSFEQPPRLQPEFDFDCPPRPDMPSSQPIDIPDAKKRP
KKKKRCRATDSFSGRFEDVYQLQEEVLGEGAHARVQSCINLITNKEYAVKIIEKRRGHIR
SRVFREVEMLYQCQGHRNVLELIEFFEEEERFYLVFEKMRGGSILTHIHRRRHFNELEAS
VVVRDIARALHFLHNKGIAHRDLKPENILCESPDQVSPVKICDFDLGSGIKLNGDCSPIS
TPELLTPCGSAEYMAPEVVEAFSEEASIYDKRCDLWSLGVILYIMLSGYPPFVGHCGSDC
GWDRGEACPTCQNMLFESIQEGKYEFPDKDWAHISFGAKDLISKLLLRDAKKRLSAAQVL
EHPWVQGCAPDNTLPTPIILQRNSSAKELTSFAAEAMAVNRQLTQRDEDEEEEEERPIII
KAASRAVQLSPPSESQLAQRRQRSSAAKAVAAGQHLVTPLVLVADQA
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggtgcagaagaaatcggagctcgcggggttccaccgctccttcacgggccagaacccc
ttcgagctgtcgttcgagcagcccccccgcctgcagcccgaatttgactttgactgccca
ccccggcctgacatgccctccagccaacccatcgacatccccgacgccaagaagcgcccc
aagaagaagaagcgctgcagagccaccgacagcttctcggggcgctttgaagacgtgtac
cagctgcaggaggaggtgttgggggaaggggcccacgcccgagtgcagtcctgcatcaac
ctcatcaccaacaaggagtacgccgtcaagatcatcgagaagcgccgcgggcacatccgc
agccgcgtgttccgggaggtggagatgctctaccagtgccagggccataggaacgtgctg
gagctgatcgagttcttcgaggaggaggagcgcttctacctcgtgttcgagaagatgcgg
ggcggctccatcctgacccacatccaccggcggcgccacttcaatgagctggaggccagc
gtggtggtgcgggacatcgcgcgcgccctgcacttcctgcacaacaagggaatagcacac
agggatctgaagccggagaacatcctgtgtgagagcccggaccaggtgtcccccgtgaag
atctgtgacttcgacctgggcagtggcatcaaactgaacggggactgctcccccatctcc
accccagagctgctcaccccgtgcggctcggctgagtacatggccccggaggtggtggag
gccttcagtgaggaggcgtccatctacgacaagcgttgcgacctgtggagcctgggggtg
atcctgtacatcatgctcagtgggtacccccccttcgtgggccactgcggctctgactgc
ggctgggaccggggcgaggcgtgccccacctgccagaacatgctgtttgagagcatccag
gagggcaaatacgagttccccgacaaggactgggcacacatctcctttggggccaaagac
ctcatctcgaagctgctgctgcgggacgccaagaagcggctcagtgctgcccaggtcctg
gagcacccctgggtgcaggggtgcgccccggataacaccctgccgacccccatcatcctg
cagaggaacagcagtgccaaagaactcacctccttcgccgcagaggccatggccgtcaac
aggcagctgacccagcgcgatgaggacgaggaggaggaggaggagcgccccatcatcatc
aaagcagcctccagggccgtgcagctctcgccgccctccgagtcccagctggcgcagcgg
cggcagaggagcagcgcggccaaagcggtggctgcggggcagcacctggtgaccccgctg
gtcctggtggccgaccaggcctga

DBGET integrated database retrieval system