KEGG   Gallus gallus (chicken): 429283Help
Entry
429283            CDS       T01006                                 

Gene name
DLX1
Definition
(RefSeq) homeobox protein DLX-1
  KO
K09314  homeobox protein DLX1/4/6
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    429283 (DLX1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Dll
    429283 (DLX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN Homez YdaS_antitoxin
Motif
Other DBs
NCBI-GeneID: 429283
NCBI-ProteinID: NP_001039307
CGNC: 53614
Ensembl: ENSGALG00000018439
UniProt: Q6DV98
Position
7
AA seq 255 aa AA seqDB search
MTMTTMPESLNSPVSGKAVFMEFGPPGQQMSPSPMSHGHYSMHCLHSAGHSQPDSAYSTA
SSFSRPLGYPYVNSVSSHSGNPYISSVQPYPNSSGLAQPRLEETGAESEKSTVVEGGEVR
FNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKR
SKFKKLMKQGGAALESGALSNGRALSGGSPPVPAVWNTSSASGKASSGSAGTYIPSYTSW
YPSAHQEAMQQPQLM
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgaccaccatgcctgagagtctaaacagccccgtctcggggaaggccgtcttt
atggagttcgggccgcccggccagcaaatgtctccttctcccatgtcccacggacactat
tccatgcactgtttacactcggcgggccactcgcagcccgacagcgcgtacagcacagct
tcgtccttctcccgaccgctgggctacccctatgtgaactcggtgagcagccactccggc
aacccctacatcagttcagtgcagccctaccccaacagctccggcctggcccagccccgg
ctggaggagacaggggccgaatcggagaaaagcactgtggtagaaggaggggaagttcgc
tttaatgggaaagggaaaaaaatccgcaaacccaggactatttattccagtttgcagctg
caggctctgaacaggaggttccagcaaacccagtacctggccctgcccgagagagccgag
ctcgcggcctctctgggactcacccagactcaggtgaagatctggttccagaacaagcgc
tccaaattcaagaagctgatgaagcagggaggggcggccctggagagcggcgccctgagc
aacggccgggccctgtccggcggctctcccccggtgcccgccgtgtggaacacctcctcc
gcctccgggaaggcgtcctcgggcagcgccggcacctacatccccagctacacgtcgtgg
tacccctcggcccaccaagaagctatgcagcagccgcagcttatgtga

DBGET integrated database retrieval system