KEGG   Gallus gallus (chicken): 429367
Entry
429367            CDS       T01006                                 

Gene name
P2RX6
Definition
(RefSeq) P2X purinoceptor 6 isoform X3
  KO
K05221  P2X purinoceptor 6
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    429367 (P2RX6)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    429367 (P2RX6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    429367 (P2RX6)
Ion channels [BR:gga04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   429367 (P2RX6)
SSDB
Motif
Pfam: P2X_receptor UPF0014
Other DBs
NCBI-GeneID: 429367
NCBI-ProteinID: XP_015130854
CGNC: 53634
Ensembl: ENSGALG00000026902
Position
15
AA seq 405 aa
MATPAGGGAALCGPLLDYKTEKFALTRNRRVGLLHRLLQLAVLGYVLGWVFVVRRGYQDT
DAAPRVSVVTKLKGVSVSRPEDARRRLWDAADFSRPPQGENVLFLVTNFIVTDRQVQGTC
PESPSVLDGICMEDVDCSVGNPVVHGNGIKTGRCVMFNSTHSTCEIFGWCPVENDTLPRA
LLLCRKPLLAEAENFTLFIKNTVNFTKFNFSKGNTLQTNDPTYFKTCMYDPFFSPSCPVF
RIRDMVEAAGETFGALALMGGSISVRIEWDCDLDWPAAHCQPRYSFILLDRRYNFRTASY
YWDSKRQHYRSLLKLYGIRFDISVHGQAGKFGIIPAAVSFGTGIAFLGTATIICDMVLLY
LDAKADLYWKEKFEEAKPPKGKKAAAAEAQRAGQDLGDAQQCALE
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggcgacgccggccggcggaggcgccgcgctgtgcgggccgctgctggattacaagacc
gagaagttcgcgctgacgcggaaccggcgcgtggggctgctgcaccgcctgctgcagctc
gccgtgctgggctacgtgctggggtgggtgttcgtggtgcggaggggttaccaggacacc
gatgccgctccacgcgtctcggtcgtcaccaagctgaagggagtgtccgtcagccggccg
gaggacgcgcggagacggctctgggacgcggcggatttctcgaggcccccgcagggagaa
aatgtgcttttcttggtgaccaacttcattgtgacggacaggcaggttcagggcacctgt
cccgagagcccctctgtgctggatgggatctgcatggaagatgtggactgttctgtggga
aacccggtggttcatggcaatgggattaagactgggagatgcgtgatgttcaacagcacc
cattccacctgtgagatctttggctggtgccccgtggagaatgacaccctgcccagggct
ttgttgctttgcaggaaacctcttctggctgaggcagagaatttcactctttttataaaa
aatactgtcaacttcaccaaatttaacttctccaagggcaacacattgcagaccaacgac
cccacctatttcaagacctgcatgtacgacccctttttcagcccttcctgccctgtgttc
cgtatccgtgacatggtggaagcagctggggagacctttggggccctcgcattgatggga
ggaagcatcagcgtgcgcattgagtgggactgtgacctggactggcccgctgcccactgc
cagccacgctactccttcatcctgctggacaggaggtacaacttcagaacagcctcctac
tactgggactcaaagcggcagcactaccggagcctgctgaagctctatggcatccgcttt
gacatctctgtgcacggccaggctgggaagttcggcataattcctgctgctgtcagcttc
ggcaccggcatcgcattccttggaaccgccaccatcatctgtgacatggttctgctctac
ctggatgcgaaggctgacctctattggaaggagaagtttgaggaggcaaaacctcccaaa
ggtaagaaagcagcagcagctgaggcacagagggctggccaggacctgggggatgctcag
caatgcgcactggagtga

DBGET integrated database retrieval system