KEGG   Gallus gallus (chicken): 429400
Entry
429400            CDS       T01006                                 

Gene name
HOXC12
Definition
(RefSeq) homeobox protein Hox-C12
  KO
K09297  homeobox protein HoxC/D12
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    429400 (HOXC12)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    429400 (HOXC12)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN Homez
Other DBs
NCBI-GeneID: 429400
NCBI-ProteinID: XP_426957
CGNC: 13573
UniProt: A0A1D5PG80
Position
33
AA seq 267 aa
MGEHNLLNPGFVGPLVNIHTGDTFYFPNFRTSGGQLPGLPSLSYPRRDNVCSLPWASSEP
CNGYPQPYLGSPVSINPSFGRACDLARVEESKCYYRESCSDTAGLKREERGRDSALLPLE
SGLPNGMGGNFSKYDYPGAEAVPHDPPSCQSLESDSSSSLLNEGNKGTAGEAGGLVSPLN
QGSTLGTGGAPWYPMHTRSRKKRKPYSKLQLAELEGEFMVNEFITRQRRRELSDRLNLSD
QQVKIWFQNRRMKKKRLLLREQALSFF
NT seq 804 nt   +upstreamnt  +downstreamnt
atgggcgagcacaacctccttaatcccggctttgtgggacctctggtgaacatccacacg
ggagacaccttctacttcccaaatttccgaacctccggagggcagctgccgggtctgccg
tccttatcgtacccccgacgggacaacgtctgctccttaccctgggcgtcctcggagccc
tgcaacgggtacccgcagccctacctgggcagccccgtctccattaacccttcgttcggc
agagcttgcgatctcgcccgggtggaagaaagcaaatgctactaccgggagagctgctcc
gacacggccgggctcaagcgggaggagaggggcagggacagtgccttgctgcccctcgaa
tccggcctccccaatggcatggggggcaatttcagcaaatacgactatcccggagccgag
gcggtgccccacgaccctccgtcgtgtcaatccttggagtcagactccagctcgtctttg
ctcaatgaagggaataaaggcacagcgggcgaagcggggggtttggtgtcccccctcaac
caaggcagcactttaggcaccggtggtgctccttggtacccgatgcacacacggtcccgg
aaaaaacgcaaaccctattccaagctgcagctggcggagctggagggggagttcatggtc
aatgaattcattactcgccaaagaaggagggagctctcagaccgattaaacctgagcgac
cagcaggtgaagatctggttccagaaccgacgcatgaaaaagaaaagactcctcctgagg
gagcaagccctgtctttcttttaa

DBGET integrated database retrieval system