KEGG   Gallus gallus (chicken): 430099
Entry
430099            CDS       T01006                                 

Gene name
P3H4
Definition
(RefSeq) endoplasmic reticulum protein SC65
  KO
K22461  endoplasmic reticulum protein SC65
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:gga03110]
    430099 (P3H4)
Chaperones and folding catalysts [BR:gga03110]
 Other chaperones and cochaperones
  Others
   430099 (P3H4)
SSDB
Motif
Pfam: TPR_18 YfiO
Other DBs
NCBI-GeneID: 430099
NCBI-ProteinID: XP_427657
CGNC: 53856
Ensembl: ENSGALG00000027462
UniProt: R4GH52
Position
27
AA seq 434 aa
MGCAALALLLLLLAAGPCAAQYEQYSVRGFPAAALEPLQRAYARALAQYAGAQWAESARA
LEASLRLHRLLRDSEAHCHRRCAEGGSAEEPPAEGDRAEWEWERELQLFGRLLRRAGCLR
ACKRGLPVFQLRYPPAQTLRDFQRRLPYQYLHYALFKSNKIEKAVSAAHTFLQKNPKHEM
TLKYLNYYRTMVDVDEYLVDLEAQPYEPIFVRSVKLYNNGDFRSSAADMEQALAEYYKAY
EDCLAGCEGAYELQEFKDFYPAIADHFVSVLRCKVGCESELTPNVGGYFVEKFVATMYHY
LQFAYYKLNDVRDAVRSVSSYMLFDPDDAVMQQNLVYYRFHRERWHLQEEDFEPRPEAVR
YYNRTAAQKKMLEFARQYLQADDEMEVDDGEEPDLRDLPSDGEFEGEGDYEEGFFAEWWQ
EPNTKGDKADEETL
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgggctgcgcggcgctggcgctgctgcttctgctgttggcggcggggccgtgcgcggcg
cagtacgagcaatacagcgtgcgcggattccccgcggccgcgctggagccgctgcagcgc
gcttatgcgcgagcgctggcgcagtacgcgggcgcgcagtgggcggagagcgcgcgggcg
ctggaggccagtctgcggctgcaccgcctgctgcgcgacagcgaggcgcactgccaccgc
cgctgcgccgaagggggatccgcggaggagccccccgcggaaggggaccgcgcggagtgg
gagtgggagcgggagctgcagctcttcgggcggctgctgcgccgcgcgggctgtttgcgt
gcctgtaagcgcggcctgcccgtcttccagctgcgctacccccccgcgcagacgctgcgc
gatttccagcgccgcctgccctaccagtacctgcactacgcgctcttcaagtccaataag
atcgagaaggcggtgtccgctgctcacaccttcctgcagaagaaccccaagcacgagatg
accctgaagtacctgaactactacaggacgatggtggatgtggatgaatacctcgtggac
ctggaggctcagccctatgagccaatctttgtgcgctcggtgaagctgtacaacaacggg
gatttccggagcagcgcggctgacatggagcaggctctggctgagtactacaaggcgtat
gaggattgcctggctggctgtgagggcgcctatgagctgcaggagttcaaggacttttac
ccggccatcgcagaccactttgtgagcgtgctgcgctgcaaggtgggctgcgagagcgag
ctcacccccaacgtgggcggctactttgtggagaagttcgtggccaccatgtaccactac
ctgcagttcgcctactacaagttgaatgacgtgcgggatgcggtgcgcagtgtctccagc
tacatgctcttcgacccggatgacgcggtgatgcagcagaacttggtgtactatcgcttc
caccgcgagcgctggcacctgcaggaggaggacttcgagccccggccggaagccgtgcgc
tactacaaccggacggctgcgcagaagaagatgctggagttcgccaggcagtacctgcag
gctgatgatgagatggaggtggatgatggtgaggagccggacctgcgggatctgccctca
gacggcgagtttgagggcgaaggggactatgaggagggcttcttcgcagagtggtggcag
gaacccaacaccaagggggacaaagccgacgaagagacgctctga

DBGET integrated database retrieval system