KEGG   Gallus gallus (chicken): 430150Help
Entry
430150            CDS       T01006                                 

Gene name
CACNA2D2
Definition
(RefSeq) voltage-dependent calcium channel subunit alpha-2/delta-2 isoform X1
  KO
K04859  voltage-dependent calcium channel alpha-2/delta-2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    430150 (CACNA2D2)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    430150 (CACNA2D2)
   04261 Adrenergic signaling in cardiomyocytes
    430150 (CACNA2D2)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   430150 (CACNA2D2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VGCC_alpha2 VWA_N VWA VWA_3 VWA_2 dCache_1 dCache_2 ExsD G6PD_N VWA_CoxE
Motif
Other DBs
NCBI-GeneID: 430150
NCBI-ProteinID: XP_015148271
CGNC: 15287
Ensembl: ENSGALG00000038242
Position
12
AA seq 1126 aa AA seqDB search
MAMAAPTGSAAPVAPALCGHLALLLLLAAPAAHGYSFPQQHTMQYWARRLEQEIDGVMRI
FGGVQQLRGIYNENRNLFEVKENVPRKLVEKVAGDIESLLAKKVRALKRLANAAEKFQKA
HHWQDNIREEDIEYYDSKADTEFVSAVSTDDPDGEEIEREKSNSLKLEFTDDANFKTKVN
YSYAAVQIPTDIYKGSTVILNELNWTQALEDVFIENRKEDPSLLWQVFGSATGVTRYYPA
TPWRAPNKIDLYDVRRRPWYIQGASSPKDMVIIVDVSGSVSGLTLKLMKTSVCEMLDTLS
DDDYVNVASFNEKAKPVSCFKHLVQANIRNKKVFKEDVQGMVAKGTTDYKAGFEYAFDQL
QNSNITRANCNKMIMMFTDGGEDRVQDVFEKYNWPNKTVRVFTFSVGQHNYDVTPLQWMA
CANKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAGNRAKQVQWTNVYQDALGLGLVVTGT
LPVFNLTEDNSDRKNQLILGVMGIDVALNDIKKLTPRYNLGANGYVFAIDLNGYVLLHPN
LQPQIINFREPVTLDFLDAELEDENKEEIRRSMIDGNDGQRFIKTLIKSLDEQYIDEVFR
TYTWAPIKSTNYSLGLVLPPYSTYYIQANLSDQILQVKLPNIKMKDFEYLLPNSFESEGH
VFIAPREYCKDLDLSDNNTEFLENFIALMEKVTPDSKQCDNFLLHNLILDTGITQQLVER
VWKDQDLNTYSLLAVFAATDGGITRVFPNKAADDWEEEPEPFNASFYRRSLDNKGYIFKP
PYRDDGYRGLDLENNTIGILVSTAVELSIGGKTLKPAVVGVKLDLEAWAEKFKVLASNRT
DRDQLGSRRCDPSSSCEMDCEANNKDLICVLIDDGGFLVLSNQEDHWYQVGKFFSEVDAN
LMSALYNNSFYARKESYDFQSVCAPEAQSNTGAAPRGVFVPTVADLLSLAWWTSAAAWSL
FQQFLYSLTYSSWFQTEDVMADGMEARETSCIMKQTQYYFSTVNATYNAIIDCGNCSRLF
HAQRLANTNLLFVVADKPLCSQCESVKLLQAEVRAPPRDPNQCELVDRPRYRKGPHICFD
YNATEDTSDCGRGASFTPSLGVLLSLQLLLLYASTSRHPLPPAACL
NT seq 3381 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggcggctccgaccggcagcgctgcgcccgtcgccccggcgctctgcggccac
ctggccctgctgctgctcctcgccgcccccgccgcgcacggctacagcttcccccagcag
cacactatgcagtactgggccagaaggctggagcaggagattgatggcgtgatgaggata
tttggtggcgtccagcagctcagagggatctacaatgagaacagaaacctgtttgaagtc
aaggagaacgtgcccagaaaattagtggagaaggttgcaggggacatcgagagcctgctg
gccaagaaagtccgtgctttaaagaggctggccaacgcagcagagaagttccagaaggcc
caccactggcaggacaacatccgggaggaggacatcgagtactacgactccaaggcggac
acggaattcgtgagtgctgtgagtactgatgatcccgatggggaagaaatcgagcgggag
aaatccaactcccttaagctggagttcaccgacgatgccaacttcaagaccaaggttaac
tactcatatgctgccgtgcagatccccactgacatctacaaaggctccaccgtgatcctc
aacgagctgaactggacgcaggcgctggaggacgtcttcattgagaaccgcaaggaagac
ccctccctgctctggcaggtcttcggcagcgccaccggcgtcacccgctactaccctgcc
accccatggagagcacccaataagatcgacctgtatgacgtgcgcagacggccctggtac
atccagggtgcttcgtccccaaaggacatggtcatcatcgtggatgtgagcggcagtgtg
agcggcctcaccctcaagctgatgaagacctcggtctgtgagatgctggacacgctctcg
gatgatgactacgtcaacgtggcctcgttcaacgagaaggcaaagccggtgtcatgcttc
aagcacctggtgcaggccaacatccgcaacaagaaggtcttcaaggaggatgtgcagggc
atggtggccaagggcacgactgactacaaggctggctttgagtatgccttcgaccagctg
cagaattccaacatcacacgtgccaactgcaacaagatgatcatgatgttcacagacggt
ggtgaggaccgggtgcaggacgtctttgagaagtacaactggcccaataagacggtgcgt
gtctttaccttctccgtggggcagcacaactatgacgtgaccccactgcagtggatggca
tgcgccaacaaaggttactacttcgaaatcccctctatcggcgccatccgcatcaacaca
caggagtacctggatgtgctgggcaggcccatggtgctggctgggaaccgtgccaagcag
gtgcagtggaccaacgtctaccaggatgcgctggggctggggctggtggtgacaggcacg
ctgcccgtgttcaacctgacagaggacaacagtgacaggaagaaccagctcatcctgggt
gtgatggggatcgacgtggcgctgaacgacatcaagaagctgacaccacgatacaatctg
ggcgccaatggctacgtcttcgccattgacttgaatggctacgtgctgctgcaccccaac
ctgcagccccagatcatcaatttccgtgagccggtgacgctggacttcctggacgccgag
ctggaggacgagaacaaggaggagatccggagaagcatgattgatgggaacgatgggcag
aggttcatcaagacacttatcaagtcgctggacgagcaatacatcgacgaggtgttcagg
acctacacgtgggctcccatcaaaagcaccaactacagcctggggctggtcctgcccccc
tacagcacctactacatccaggccaacctcagtgaccagatcctgcaagtgaagttacca
aacatcaaaatgaaggattttgaatacctgctgcccaacagctttgagtcggagggacat
gtgttcattgctcccagagagtattgcaaagacctcgacttgtcagataacaacaccgag
ttcctggagaactttattgccctcatggaaaaggtgaccccagactccaagcagtgtgac
aatttcctcctgcacaacctaatcctggacacgggcatcacacagcagctggtggagcgc
gtctggaaggaccaggacctcaacacgtacagtctcctggctgtcttcgctgccacagat
gggggcatcacccgtgtcttcccaaacaaagccgcagatgactgggaggaggaaccggag
cccttcaacgccagcttctaccgcaggagcctggataacaagggctacatattcaaaccg
ccctaccgggatgatggctaccgggggctggatctggagaacaacaccattgggatcctg
gtgagcaccgccgtggagctcagcatagggggcaagacgctaaagccagcagtggtcggg
gtgaagctggacctggaggcctgggcagagaagttcaaggttctggcaagcaaccggaca
gaccgcgaccagctgggctcccgccggtgtgacccctcgagtagctgtgagatggactgc
gaggccaacaacaaggacctcatctgcgtcctcattgatgacggaggcttcctggtgctc
tccaaccaggaggatcactggtaccaggtgggcaagttcttcagtgaggtggacgccaac
ctgatgtctgccctctacaacaactccttctacgcccgcaaagagtcctacgacttccag
tccgtctgtgccccggaggcccagagcaacacgggtgctgcaccacgtggtgtctttgtg
cccaccgtggccgacctgctgagcctggcctggtggacctcggcggcagcctggtccctc
ttccagcagttcctctacagcctcacctacagcagctggttccagacagaggacgtcatg
gcagacggcatggaggcgagggagacgagctgcatcatgaagcagacgcagtactacttc
agcaccgtcaacgccacttacaacgccatcatcgactgcgggaactgctcgaggctgttc
catgcgcagaggctggccaacaccaacctgctcttcgtggtggctgacaagcccctgtgc
agccagtgcgagtccgtcaagctgctgcaggccgaggtcagggctcccccgagagacccg
aaccagtgtgagctggtggacaggccccgctaccggaaaggcccccacatctgcttcgac
tacaatgcaacagaagatacctcagactgcggccgaggggcgtccttcaccccctccctc
ggggtcctgctctccctgcagttgctgctcctctacgccagcaccagccggcacccgctg
cccccggccgcctgcctttaa

DBGET integrated database retrieval system