KEGG   Gallus gallus (chicken): 430270
Entry
430270            CDS       T01006                                 

Gene name
POU3F1
Definition
(RefSeq) POU domain, class 3, transcription factor 1
  KO
K09365  POU domain transcription factor, class 3
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    430270 (POU3F1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   POU domain factors
    430270 (POU3F1)
SSDB
Motif
Pfam: Pou Homeodomain HTH_31 Homeobox_KN
Other DBs
NCBI-GeneID: 430270
NCBI-ProteinID: NP_001026755
CGNC: 53900
UniProt: O73861
Position
23
AA seq 372 aa
MAAAAQYLPRSAGLLHPDGDRLHQGTTYREVQKMMHHEYLQGLAPAAAGHAVGLAHHQWL
PSAGTDWGSGGGGGGGAHLPPAAEHGKGGPGGPREELPPAAAFHPRPHLVRTGRWAQGGA
APHLPPMSPPSGQPLLYGQPYGGLNGMLGPPGPALHHGHGLRDPLGAEEAAGHELAASPP
PPLGPPEPSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRF
EALQLSFKNMCKLKPLLNKWLEETDSSTGSPTNLDKIAAQGRKRKKRTSIEVGVKGALEN
HFLKCPKPSAHEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPAGLPHPPMEDVYAQADT
SPLHHALPGAVP
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggccgccgccgcgcagtacctcccgcgctccgccggcttgctgcaccccgacggcgac
cgcctgcatcagggcaccacgtaccgcgaggtgcagaagatgatgcaccacgagtacctg
cagggcctggcccccgccgccgccgggcacgccgtcgggctggcgcaccaccagtggctg
cccagcgccggcacggactggggcagcggcggaggaggaggaggcggcgcgcacctcccg
ccggcggccgagcacggcaagggcggcccggggggcccccgcgaggagctgccccccgcc
gccgctttccacccgcggccgcacttggtgcgcacggggcggtgggcgcagggcggggcc
gcccctcacctgcccccgatgtcgccgccgtcggggcagccgctgctttacgggcagccc
tacggcggcctcaacgggatgctgggcccccccggccccgcgctgcaccacgggcacggg
ctgcgcgacccgctgggcgccgaggaggcggcgggccacgagctggcggcctccccgccg
ccgccgctggggccgcccgagccgtcggacgaggacgcgccgagctccgacgacctggag
cagttcgccaagcagttcaagcagcggcggatcaagctgggcttcacgcaggccgacgtg
gggctcgcgctcggtaccctctacgggaacgtcttctcgcagaccaccatctgccgcttc
gaggcgctgcagctgagcttcaagaacatgtgcaagctgaagccgttgctcaacaagtgg
ctggaggagacggactccagcacgggcagccccaccaacctggacaagatcgcggcgcag
ggcaggaaacgcaagaagcgcacctccatcgaggtgggcgtcaagggcgccctggagaac
cacttcctcaagtgccccaagccctcggcgcacgagatcacctccctggcggactccctg
cagctggagaaggaggtggtgcgggtctggttctgcaaccggcggcagaaggagaagcgc
atgacgccggccgggctccctcacccgcccatggaggacgtttacgcacaggcggacact
tcgccgctgcaccacgcgctgcccggcgccgtgccgtga

DBGET integrated database retrieval system