KEGG   Gallus gallus (chicken): 430317
Entry
430317            CDS       T01006                                 

Symbol
MYO5B
Name
(RefSeq) unconventional myosin-Va
  KO
K10357  myosin V
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    430317 (MYO5B)
   04131 Membrane trafficking [BR:gga04131]
    430317 (MYO5B)
   03029 Mitochondrial biogenesis [BR:gga03029]
    430317 (MYO5B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    430317 (MYO5B)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Cargo complex
     430317 (MYO5B)
   mRNA cycle factors
    P-body specific factors
     430317 (MYO5B)
Membrane trafficking [BR:gga04131]
 Others
  Actin-binding proteins
   Myosins
    430317 (MYO5B)
Mitochondrial biogenesis [BR:gga03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    430317 (MYO5B)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     430317 (MYO5B)
SSDB
Motif
Pfam: Myosin_head DIL IQ DUF4145 ATP-grasp_5 Myosin_N APC_rep AAA_16
Other DBs
NCBI-GeneID: 430317
NCBI-ProteinID: XP_004948778
CGNC: 9827
Ensembl: ENSGALG00000012984
Position
28:complement(1291907..1303437)
AA seq 1725 aa
MAAGQPYGQGARVWIPDCVHVWRAAEITKGYEEGDSVLHLCLEDGSPLVYPLGSQLPPLC
NPECLSGKDDLVALSHLHEPAVLHSLRVRFLEANAIYTYCGIILVAINPYKLLPIYEEEV
IYAYSGREMGDMDPHIFALAEEAYRQMARFGRNQSLIISGESGAGKTASAKYAMRYFTAV
GGGLGDSSMEEKVLASSPLMEAFGNAKTTRNDNSSRFGKYIEIGFSHGRVMGATIKTYLL
EKSRVTFQAKAERNYHIFYQLCASAALPELQGLHLCGAETFYYTQQGRCGAGTDDASDLD
STRHAFSLLGVPEADQLELFAILAAILHLGNVTIRGRDRHGDGCFVEPNSEALGLFCALL
GIEEAQVTRWLCHRKLVTAGETYMKPLSRQQALDCRDALAKHMYGQVFRWMTSRVNRALR
SPEGHHTSIGILDIYGFEMFNLNSFEQFCINYANEKLQQLFNLHVFKLEQEEYVAEEIPW
VFIDFYDNQPCIELIEGRLGVLDLLNEECKMPQGSDGSWAQKLYQTHLGSSHFQKPKRPM
DAFVVCHFAGKVEYQCDGFVEKNRDTIPEELVGLLRASKKSALLTELFLEDGDGPTSRRS
SGPRSGRPSRRSMPGTQKSKKSISSQFKSSLQRLMETLGSTTPHYVRCIKPNDSKLPFVF
DSRRAVEQLRACGVLETIRISAAGYPSRWTYQEFFERYRALLSREELVGDDAKQSCSLAL
ERLLQDPSMYRCGKSKVFFRAGQVAFLEELRCSRLRAACTLLQRHLRGWLARRRFGRIRA
AALCLQRHTRGMLARRLTTELRRSRAAVVLQKNVRMVLARRSYLRVRRAALTIQAFSRGM
FARRLYRQMVQHQKAVVLQAAVRGWLVRQRYNRLRGAVLYLQCCYRRARARRELRRLRAE
ARSVEHYKQLHKGMEIKVMQLQRRLDEQAQEKQRLAEQLSELNAAHAEEVQRLREEMRWL
REDAAHDAQVQRLQERLAELERHSAESRLAQEVEELRQRLAEVEAVKLHLGEERDALIQR
TLEQSQDLEEQHQRAARESRGLQQELEEERARYQSLVQEYARLEQGYENLRDEVAFHRQS
TLRRSPSSESFLGSESSYVSSMSTAPSRDGSDLQAEGLEERWQPPPEVPQPPHPMGDPMP
GSAAGQDPFEKAYLLLLGQLNAVTEELARTREELRRSKASAEHEERKPLDFLKRRNIAEM
LGLGRSPEKAAGDDLKHAYDAVQVANKLLVSQLQEEKQHHEEEVEGLHLDIRSLKQLSQQ
QAALIQDLQRHQGQEGLQHHVVRLKEENWELSQKLEKQERTTLKLQKQLRAYTKQIQEFT
AMKKEATTPGQEPAASPVVPSPSGPPQAMLVWRLEDEGRIIKAIITDYRPQGIPGAMPDL
PAYVLFLCIRHADHCHDEPRCHSLLDAAINAIKRVMKKHSDDFDVVALWLANACRLLNCL
RQYGRDESCQQGSTAQQNEHRLRNLDLQGPFHSLGALAVQLYQQLVRTAEKRLKPMIVAA
MLESETIQGLSSSCPPTHHRSSAPPAHTLPELLQQLGSFHQALELYGLSPAVGHQLLRQL
LFLISGTTLNYLLLRKDACSWSRGIQLRYNISQVEQWLRAQGLQQSGAREMLEPLVQAAQ
LLQVKKATEEDAGAICSLCTVLTPQQVVKILRAYTPAAGLEERVSPALISSVEKRLQEQQ
AGTPGQLLVDTNHLFPVHLPFIPSPLRLDELCIPDSVDLAFLVRL
NT seq 5178 nt   +upstreamnt  +downstreamnt
atggcggcagggcagccctatgggcagggtgcccgggtctggatccctgactgcgtccat
gtctggagagcagcagaaataactaaaggctatgaggaaggagactctgtcctgcacctc
tgcctggaggatggctcgcctctcgtttaccccctgggctctcagctgcctcccctctgc
aaccctgagtgcctctcaggcaaggatgacctggtggccctgagccacctgcatgagcca
gcagtgctgcattcactccgtgtgcgcttcctggaggccaacgccatctacacctactgc
ggcatcatcctggtggccatcaacccctacaagctgctgcccatctatgaggaggaggtg
atctatgcctacagcggccgggagatgggggatatggacccccacatctttgcgttggca
gaggaggcctacaggcagatggcgaggtttggtaggaaccagtccctcatcatcagcggt
gagtcaggagcagggaaaactgcctcagccaagtatgccatgagatacttcaccgccgtc
gggggtggtctgggggactccagcatggaggagaaggtgctggcctccagccccctcatg
gaggcctttgggaacgccaagacgaccaggaacgacaacagcagccgctttgggaagtac
attgagattggcttcagccatggccgtgtgatgggggccaccatcaagacttacctgctg
gagaagtcccgtgtcaccttccaggcaaaagcagaacggaactaccacatcttctatcag
ctctgcgcctcagccgccctgcctgagctgcagggtctgcatctgtgtggggcagagacc
ttctactacacccagcagggccggtgcggtgcaggcactgatgatgcatccgacctggac
agcacacggcacgccttctccctcctgggtgtccctgaagccgaccagctggagctcttt
gccatcctcgctgccatcctgcacctgggcaacgtcaccatcagagggagggaccgccac
ggggacggctgctttgtggagcccaacagtgaggccttggggctgttctgtgcgctgctg
ggcatcgaggaggcgcaggtgacgcgttggctctgccaccgcaagttggtgacggcgggt
gagacctacatgaagccactcagcaggcagcaggcgctggactgccgggatgccctggcc
aagcacatgtatgggcaggtcttcaggtggatgacgagcagggtcaaccgtgccctgcgc
tcaccagagggccaccacacctccatcggcatcctggacatctatgggtttgagatgttc
aacctcaacagctttgagcagttctgcatcaactacgccaacgagaagctgcagcagctc
ttcaacctgcacgtcttcaagctggagcaggaggagtacgtggctgaggagatcccgtgg
gtcttcattgacttctatgacaaccagccgtgcattgagctcattgagggccgactgggt
gtgctggacctgctgaatgaggagtgcaagatgccccagggcagtgatgggagctgggcc
cagaagctgtaccagacccatctcggcagctcccacttccagaagcccaagaggccgatg
gatgccttcgttgtgtgccactttgccggcaaggtggagtatcagtgtgatgggtttgtg
gagaagaacagagacaccatccccgaggagctggtggggctgctgagagccagcaagaag
tctgcactgctcactgagcttttcctggaggatggggatggccccacatcccgcaggtcc
agcgggcccaggtccggccgccccagccgcaggtcaatgcctggtacccagaagagcaag
aagtccatctccagccagttcaaatcctccctgcagcggctgatggagacgttgggcagc
accacaccgcactacgtccgctgcatcaaacccaacgacagcaagctgcccttcgtcttt
gactccaggagagcagtggagcagctgagagcttgcggagtgctggagaccatccggatc
agtgctgctggttacccctccaggtggacataccaggagttctttgagaggtacagggcc
ctgctgagcagggaggagctggtgggtgatgatgcaaagcagagctgcagccttgccttg
gagagactgctgcaagaccccagcatgtaccgctgcgggaagagcaaggtgttcttccgt
gccggccaggtggcattcctggaggagctgcggtgcagccggctgcgtgcagcctgcaca
ctgctgcagaggcacctgcggggctggctggcacggcgccgctttggccgcattcgtgct
gcagctctgtgcctgcagcgtcacacccggggcatgttggcacgcaggctcaccactgag
ctgcggaggagcagagctgcggtggtgctgcagaagaatgtgaggatggtgttggctcgg
cgctcctacctgcgtgtgcgccgggctgccctcaccatccaggccttcagccgggggatg
tttgctcgacgcctctaccgccagatggtgcagcaccagaaagctgtggtgctccaggct
gctgtgaggggttggttggtccgccagcgctacaaccgtctgcgcggggctgtgctctac
ctgcagtgctgctaccgccgggcacgggcacgccgtgagctgcgccggctgcgggctgaa
gcacgctcagtggagcactacaagcagctgcacaagggcatggagatcaaggtgatgcag
ctgcagcgcaggctggatgagcaggcccaggagaagcagcgattggcggagcagctgtcg
gagctgaacgccgctcacgctgaggaggtgcagcggctgcgggaggagatgcggtggctg
cgggaggatgcagcgcacgatgctcaggtgcagcggctgcaggagaggctggccgagttg
gagaggcacagtgctgagagccgcctggcccaggaggtggaggagctccggcagcgcctg
gcagaagtggaagccgtgaagctgcacctgggggaggagagggatgctctgattcagcgc
accttggagcagtcgcaggacctggaagagcagcaccaacgtgcagcgcgggagagccgg
gggctgcagcaggagctggaggaggagcgggcgcgttaccagagcctggtgcaggaatac
gcccgcctggagcagggctatgagaacctgcgggacgaggtggccttccataggcaaagc
accctcagacgttccccttcatccgagagcttcctgggctctgagagcagctacgtgtcc
tccatgtccaccgccccctctcgggatggctccgacctacaggctgaggggctggaggag
cgctggcagccaccacctgaggtccctcagcctccccaccccatgggggaccccatgcct
ggcagcgctgcggggcaggacccctttgagaaggcgtatctgctgctgctgggacagctc
aatgctgtcaccgaggagctggcccgcacccgggaggagctgaggaggagcaaagcatct
gccgagcacgaggagaggaaacccctggatttcctcaagcgaaggaacatcgctgagatg
ctggggctgggcaggagccccgagaaggcggcgggggatgacttgaagcacgcgtacgat
gcagtgcaggtggccaacaagctgttggtgagccagctgcaggaggagaagcagcaccac
gaggaggaggtggaggggctgcacctcgacatccgctcactcaagcagctgagccagcag
caggcagccctcatccaggacctgcagcggcaccagggccaggaggggctgcagcaccac
gtcgtgcgcctcaaggaggagaactgggagctgtcccagaagctggagaaacaggagagg
accacactgaagctgcagaagcagctgagagcctacacgaagcagatccaggagtttaca
gcaatgaagaaagaggccaccacaccggggcaggagccagcagcatcccctgtggtccca
tccccatcggggccaccccaggccatgctggtatggagactggaggacgaagggcgcatc
atcaaggccatcatcacagattatcgccctcagggcattcctggggcaatgccagacctt
ccagcctacgtcctcttcctctgcatccggcacgcggaccactgccacgatgagccgcgg
tgccactcactgctggatgcggccatcaatgccatcaagagggtcatgaagaagcacagt
gatgactttgacgtggtggcactctggcttgcaaatgcctgccggctcctcaactgcctg
cgccagtacggccgggatgagagctgccagcaggggagcacggcgcaacagaatgagcac
cgcctgcgcaacctggacctgcagggccccttccacagcctgggagcactggcagtgcag
ctgtaccagcagctcgtccgcacggctgagaagcgcctcaagcccatgattgttgccgca
atgctggagagtgaaaccatccagggcctgtcctcctcctgccctcccacccaccaccgc
tcctcggcccccccagcccacaccctgcccgagctcctgcagcagctgggctccttccac
caggccctggagctctatgggctgtccccggccgtggggcatcagctgctgcgccagctc
ctcttcctcatcagcggcaccaccctcaactacctgctgctgaggaaggacgcgtgctcc
tggagccgtggcatccagctcaggtacaacatcagccaggtggagcagtggctgcgggcg
caggggctgcagcagagcggtgcccgtgagatgctggagccgctggtccaggctgcacag
ctgctgcaggtgaagaaggcgacagaggaggacgcaggggccatctgcagcctgtgcacc
gtgctgaccccacagcaggtagtgaagatcctacgggcgtacactccggctgctgggctg
gaggagcgcgtgagccctgccctcatcagcagtgtggagaagcggctgcaggagcagcag
gcagggactcccggccagctcttggtggacaccaaccacctcttccctgtgcacctgccc
ttcatcccctccccgctgcgcctggacgagctctgcatccctgacagcgtggacctggcc
ttcctcgtgcgtctctga

DBGET integrated database retrieval system