KEGG   Gallus gallus (chicken): 430534
Entry
430534            CDS       T01006                                 

Symbol
FOXM1
Name
(RefSeq) forkhead box protein M1
  KO
K09406  forkhead box protein M
Organism
gga  Gallus gallus (chicken)
Pathway
gga04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    430534 (FOXM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    430534 (FOXM1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    430534 (FOXM1)
SSDB
Motif
Pfam: Forkhead
Other DBs
NCBI-GeneID: 430534
NCBI-ProteinID: NP_001012973
CGNC: 53973
Ensembl: ENSGALG00000013420
UniProt: Q5ZL11
Position
1:75327522..75363582
AA seq 795 aa
MRTSPRRPLILKRRKLTLLQKEVSSTSGRDENSGHDEKTPKQEHSQNDQNDSQCRDKIDC
GLQIFSAGIKIMNHPTMPNTQVVAIPTNADIQSIIEALTAKGKECGNNGPNKFILISSGG
TSHSAGLVLSQHLPSMEEPSTVARTANSQVREKNVSQTPDLAGGSMVWHSGIDSAFAQKR
ENSSGEAMSSVLDNSLTNIQWLGKMRTDGLTPCSVKQGMEKENQIPLRERMKTEEDSAAV
SIPSSSSWQDSVSERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHVAKPGW
KNSIRHNLSLHDMFARETSANGKISFWTIHPDANRCLTLDQVFKPLDFGSTSSEHSESQQ
KQHVPDPQKNMGSKSSSKTEPQNARRKMKPLLPRINSYLVPIQFPMSQPLVLQPPLKVPL
SVAQGTSHNSSETFQSNKRVRIAPKMSFSIEESSSLPVATVKEESQCDEGFFSPTHSLKE
NNCQPGDEPCSFPETLCIKEEEGLQLGDWLSPFASTVTVKEEPDSFVPVSAVMEKKCFTI
LKSPSKGVSDALVIKRCERREMSRSRRKQHLALPCSEEPVLIFPESNEFDPFQLGADLPL
LQENQPLENASQLRCLQEERGPFKTPVKEMFSKLPVSSTPCKVPATTTPPLGGLDPWKSA
LSAKRGNELDFSPVRTLPLPFTPCQENQDLLGFNSTPLKSPLPESSWELLNTESNDTVHS
PLTSSPSFSHKSTKQLSLELPASGFTENRSLVEGLILDTMNDSLSKILLDISFPGLEDEN
LGTDISWSQLIPELK
NT seq 2388 nt   +upstreamnt  +downstreamnt
atgaggaccagccctcgtaggcctttaattctcaaaagaaggaaactgacccttctacag
aaggaggtatccagtacttcaggaagagatgaaaacagtggtcatgatgaaaagacaccc
aagcaggagcacagccagaacgaccaaaatgacagccaatgcagagacaaaatagactgt
ggactacagatattctcagcgggaataaagataatgaaccatcctaccatgcccaacaca
caagtggtggccatccctacaaatgcggatatccagagcatcatagaggccctgacagca
aaaggaaaagaatgtggcaacaatgggcccaataagttcattctcattagtagcggggga
acttctcattcagcaggtttggtactatcacagcaccttccctcaatggaggaacctagc
acagtggctaggactgcaaatagtcaagtaagagagaagaatgtttcacagacacctgat
cttgcaggaggatcaatggtctggcattcaggaattgattctgcatttgcacagaaacgg
gagaacagcagtggcgaggcaatgagctctgtgctggataatagtctcactaacatccag
tggctggggaagatgagaactgatggactaactccctgttctgtgaagcaaggcatggag
aaagagaaccagatacctctgcgggaaagaatgaagactgaagaagattctgctgctgtt
tccataccctcttcttcctcatggcaggattcagtatcagaacgacctccatactcctac
atggccatgatccagtttgccatcaacagcactgagaggaagcgtatgactctgaaagac
atctatacctggattgaggatcatttcccatattttaagcatgtggctaagccaggttgg
aagaactctattcggcataacctgtccctccatgatatgtttgcccgtgagacgtctgct
aatggtaaaatctcattctggactattcaccctgatgccaaccgttgcctaactttggac
caagtgtttaagccgctggactttgggtcaacatcgtctgagcactctgaatcacaacag
aagcaacatgtcccagatccccagaagaacatgggaagcaaaagtagcagcaaaactgaa
ccccagaatgcacgacgaaagatgaagcctttgcttcctcgcatcaactcctaccttgtt
ccgatccagtttccaatgagtcagcctcttgtcctgcagcctcctttgaaggttcctctc
tctgtggcacagggaacatcccacaacagctcagagaccttccagagcaataaacgtgtg
cgcattgctccaaagatgtcgttctctattgaagagtcatcctctttacccgtggctaca
gtcaaagaagagagccaatgtgatgaaggatttttttccccaacacattctctgaaggag
aacaactgtcagcctggtgatgaaccatgttctttccctgagacactctgtattaaggaa
gaggaaggcttacagctgggagactggctgtccccttttgcttcaaccgtaactgtaaag
gaagagccagactcatttgtcccagtctcagccgtgatggagaagaaatgtttcaccata
ctgaagtcaccatctaagggtgtttctgacgcattagttataaagaggtgtgagaggcgg
gaaatgagcagatccagaaggaaacaacacctagcactgccttgctcagaagagcctgtc
cttatcttcccagagagcaatgaatttgatcctttccagttaggggcagacctcccctta
ctgcaggaaaaccagcctctagagaatgcatcacagctgagatgcctgcaggaggaaagg
gggccttttaaaacaccagtcaaagagatgttcagcaaattgccagtttcttccactccc
tgcaaagtcccagcaactactactcccccactagggggccttgatccctggaagtctgca
ctgtcagccaagagaggtaatgagctggatttcagtccagtgagaacccttccgctgccg
ttcacaccctgccaggagaaccaggacttgctgggttttaacagcacaccccttaaaagt
cctctccctgagtcttcttgggaactgctcaatacagaatccaacgacacagtacacagc
cccctcacaagctctccatcttttagtcacaaatctacgaagcagttgtcccttgaactg
ccagcctctggttttactgaaaaccgatcactcgtggagggcctgattttggacaccatg
aatgacagtttgagcaaaatccttttagatatcagctttcctggtcttgaggatgaaaac
ttaggaacagacattagttggtctcagcttatacctgaactgaagtaa

DBGET integrated database retrieval system