KEGG   Gallus gallus (chicken): 430557Help
Entry
430557            CDS       T01006                                 

Gene name
ACACB
Definition
(RefSeq) LOW QUALITY PROTEIN: acetyl-CoA carboxylase 2
  KO
K01946  acetyl-CoA carboxylase / biotin carboxylase 2 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00061  Fatty acid biosynthesis
gga00620  Pyruvate metabolism
gga00640  Propanoate metabolism
gga01100  Metabolic pathways
gga04910  Insulin signaling pathway
gga04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    430557 (ACACB)
   00640 Propanoate metabolism
    430557 (ACACB)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    430557 (ACACB)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    430557 (ACACB)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    430557 (ACACB)
   04920 Adipocytokine signaling pathway
    430557 (ACACB)
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     430557 (ACACB)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     430557 (ACACB)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     430557 (ACACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATPgrasp_Ter Dala_Dala_lig_C ATP-grasp ATP-grasp_3
Motif
Other DBs
NCBI-GeneID: 430557
NCBI-ProteinID: XP_025011460
CGNC: 53981
Ensembl: ENSGALG00000005043
Position
15
AA seq 2372 aa AA seqDB search
MLLAAVLPMIFALLILTKMSALNARNEDETPEQSPAPQPTPELAASPNPAAPSPPLQPTL
GGEQEQIAVYNPTALRRPTLAKFVLGSFEDNSSDDEVVAAAFRVSSRRSSLANAGAEPPA
TPAPQEPAVGIRPSMSGLNLTKRGREHRKMDLQRDFTVASPAEFIARFGGTRVIEKVLIA
NNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANAEYIRMADHYVPVPGGANN
NNYANVELIVDISKRIPVQAVWAGWGHASENPKLPELLQKNGIAFLGPPSDAMWALGDKV
ASTIVAQTVQIPTLPWSGSGLVAQWSEEDQKDQQMISIPLETYGQGCVKDVEEGLEVAKR
IGYPLMIKAAEGGGGKGIRKVEAAEEFGACFRQVQAEAPGSPIFLMKLAQHARHLEVQVL
ADEYGNAISLFGRDCXIQRRHQKIIEEAPITIAAPAVIEVMEKCAVRLAQMVGYVSTGTV
EYLYSEDGSFHFLELNPRLQVEHPCTEMIADVNLPAAQLQIAMGIPLHRIKDIRMLYGES
PWGDTPICFNSPANPPVPRGHVIAARITSENPEEGFKPSSGTVQELNFRSSKNVWGYFSV
AAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESF
QSNEIDTGWLDHLIAEKVQAEKPDTMLGVVCGALNVADAAFRTCMTDFLHSLERGQVLPA
ASLLNIIDVELIYEGTKYVLQVARQSLTTYVIIMNHTHIEIDVHRLTDGGLLLSYDGNSY
TTYMKEEIDRYRITIGNKTCDFEKEKDPTVLRSPSAGKLLQYTVDDGGHVAEGSVFAEIE
VMKIIMTLTVEEAGRVHYVKRPGALLEAGCVIAQLELDDPTKVKPAQPFTGGLPAQQTLP
ITGEKQHQVLRNVLDNLTNVMNGYCLPEPYFSSKVKEWVAQLMKTLRDPSLPLLELQEIM
TSISGRIPLSVEKSIRKVMAQYASNITSVLCRFPSQQIANVLDTHAATLQRKAEREVFFM
NTQSVVQLVQRYRSGIRGYMKAVVLDLLRRYLQVEMQFQQAHYDKCVISLREQYKPDMTP
VLESIFSHAQVAKKNLLVTMLIDQLCGREPTLTDELTAILNELTQLSKTEHSKVALRARQ
VLIASHLPSYELRHNQVESIFLSAIDMYGHEFCPENLKKLILSETTIFDVLPFFFYHDNQ
VVRMAALEVYVRRGYIAYELNSLQHRQLSDGTCLVEFQFMLPFSHPNRMSVPISISNPDL
ARHSTELFMDSGFSPLSQRMGAMVAFNKFEDFTRNFDEVISCFAEPPLESSLFSEARATI
YGEEDAKNIREEPIHILNIALRRADHAEDEKLVPIFRAFAQSKKNILVDCGLRRITFLIA
QQREFPKFFTFRARDEFAEDRIYRHLEPALAFQLELSRMRNFDLTAIPCANHKMHLYLGA
AKVQAGTEATDYRFFIRAIVRHSDLITKEASFEYLQNEGERLLLEAMDELEVAFNNTSVR
TDCNHIFLNFVPTVVMDPSKIEESVRAMVMRYGSRLWKLRVLQAEVKINIRLTPTTTAIP
IRLSLTNESGYYLDISLYKEVRDPSTGNIMFQSYGDKQGAQHGMLINTPYVTKDLLQAKR
FQAQXLGTTYVYDFPEMIRQALFKLWGSSELHPKDVLTYTELVLDSQGQLVQMNRLPGGN
EVGMVAFKMKLKTPEYPKGRDIMLICNDITHMIGSFGPEEDLVFLRASELARAEGIPRVY
IAANSGARIGFADEIKHMFQVAWVDPEDPYKGFKYLYLTPQDYTRISAMNSVHCEHVEEG
GESRYVLLDIIGKDHGFGVENLRAAGTIAGESSRAYDEIVTISMVTCRAIGIGAYLVRLG
QRVIQVENSHIILTGVTALNKVLGREVYTSNNQLGGVQVMHNNGISHITVPDDFEGVYTI
LQWLSYMPKDNRSPVPVIAISDPIEREIDFVPSKVPYDPRWMLAGRPHPTLKGTWQSGFF
DQGSFLEIMKPWAQTVVVGRARLGGLPVGVIAVETRTVEVTIPADPANPDSEAKIIQQAG
QVWFPDSAFKTAQAIRDFNREHLPLMIFANWRGFSSGMKDMYDEMLKFGAFIVDSLRDFK
QPVLVYIPPHAELRGGSWVVMDPTINPLYVELYADKESRGGILEPGGTVEIKFRKKDLVK
TMRRIDKVYAKLVEQLGTPELSEGQRKELEKQLKAREELLLPIYYQVAVHFADLHDTPGR
MQEKGVITDILEWKNARSFLYWRLRRLLLEEVVKLEILKANSELSHIHIQSMLRRWFMET
EGAEKGYLWDNNQVVVEWLEKHMQEDDGSKSAIRENIKYLKRDYVLKRIRSLVQANPEVA
MDCIIQMAQHITRAQKAQVAHLLSTVDSESPS
NT seq 7119 nt NT seq  +upstreamnt  +downstreamnt
atgttgctggcagccgtgctcccgatgatctttgcactgctcatcttgaccaagatgtcc
gccttaaacgccagaaatgaggacgagacccctgagcagagcccggccccacagcccacc
ccagagctggcagcctccccaaaccccgcagcccccagccccccattgcagcccaccttg
gggggggagcaggagcagattgcagtgtacaaccccaccgcgctccgccggcccaccctg
gccaagttcgtgctgggctcctttgaggacaactcctctgatgatgaggtggtagctgca
gctttcagggtgagcagccgccgcagcagcctggccaatgcaggtgctgagccccctgcc
acacctgctccacaggaacccgctgttggcataaggcctagcatgtctgggctgaacctg
acgaagcgcggccgcgagcaccgcaagatggacctgcagagggacttcaccgtcgcctca
cctgctgagttcatcgcccgcttcggggggacccgcgtcattgagaaggtcctgattgcc
aacaatggcatcgctgctgttaaatgcatgcgctccattcgccgctgggcttatgagatg
ttccgaaacgagcgcgccattcggtttgtggtcatggtcacccctgaagatctcaaggct
aacgcagagtacatcagaatggcagatcactacgtgcccgtccccggaggggccaacaac
aacaactatgccaacgtggagctgattgtggacatttccaaacggatcccagtccaggcg
gtgtgggctggctggggacatgcctcggaaaaccccaagttgccagagctgctgcagaaa
aatgggatagctttcctaggtccccccagtgatgccatgtgggcactgggggataaagtt
gcctccaccatcgtggctcagacggtccagataccaacgctgccatggagtgggagtggt
ctggtggcccagtggtctgaggaggaccagaaggaccagcagatgatcagcattcccctt
gagacgtatgggcagggctgcgtgaaggatgtggaagaaggcctggaggtggccaagagg
attgggtacccgctgatgatcaaggcagcagaaggtggtgggggcaaaggcatccgcaaa
gtggaggcagcagaggagtttggagcctgcttccgacaggtgcaggcagaggcacctggg
tcccccatcttcctgatgaagctggcccagcatgcacggcacctggaggtgcaggtgctg
gctgatgagtatggcaatgccatctccctctttggccgtgactgtnccatccagcgccgg
caccagaagatcatcgaggaggcacccatcaccattgctgctcctgctgtcatcgaggtg
atggagaagtgcgcggtacgcctggcgcagatggtgggctacgtgagcacgggcactgtc
gagtacctctacagtgaagatgggagcttccacttcctcgagctgaacccacgcctgcag
gtcgagcacccttgcacggagatgatcgcagatgtgaacctccctgctgcccagctccag
attgcgatgggcatccccttgcacaggataaaagacatccgaatgctgtatggggagagc
ccatggggcgatactcccatctgcttcaacagccctgccaacccccctgtgcccaggggc
cacgtcattgctgcacgcatcaccagtgagaaccctgaggagggtttcaagcccagctca
gggacggtgcaggaactgaatttccgcagcagcaagaatgtctgggggtacttcagtgtg
gcagctgctggggggctgcacgaatttgctgattcccagtttgggcactgcttctcgtgg
ggagagaacagagaggaggccatctcgaatatggtggtggccctaaaagagctctccatc
cgtggggatttccggaccacggtggaatatctgataaagcttttggagacggagagcttc
cagagcaatgagatcgacaccggctggctggaccatctgattgctgagaaagtgcaggca
gagaagccggacacgatgctgggtgttgtctgtggtgctctgaacgtcgcagatgctgcc
ttcaggacgtgcatgactgacttcctacactcactggagaggggccaggtgctgccagca
gcctccttgctgaacattattgacgtggagctcatctacgagggcacaaaatacgttctc
caggttgcccggcagtccttgaccacgtatgtcatcatcatgaaccacactcacatcgag
atagacgtgcaccggctgaccgacggcgggctgctgctctcctacgatggcaacagctac
accacctacatgaaggaggagatcgacaggtaccggatcacgattggcaacaaaacgtgt
gactttgaaaaggagaaggacccgacggtgctgcgctccccatctgcagggaagctgctg
cagtacacagtggatgatggaggccacgttgctgaggggagtgtttttgcagagatcgag
gtgatgaagatcatcatgacgctgacggtggaggaggcgggcagggtgcactacgtgaag
cggccgggtgcgctgctggaggcaggctgtgtcattgcacagctcgagctggatgacccc
accaaagtgaagcctgcacagccattcacaggggggctcccagcacagcagaccctcccc
attactggtgagaagcagcaccaggttctccgcaatgtgctggacaacctcaccaatgtc
atgaatgggtactgcctgcccgaaccctatttcagctccaaggtgaaggaatgggtggcg
cagctgatgaagaccctgcgggacccctccctgcccctcctggagctgcaggaaatcatg
acgagcatttcaggaagaatccctctctcggtggagaagtcaatccgcaaagtgatggct
cagtatgccagcaacatcacctccgtgctctgccgcttccccagccagcagatagccaat
gtgctggacacccacgcagccacgctgcagaggaaggctgagagggaggtgttcttcatg
aacacgcagagtgtggtgcagctggtgcagaggtaccgtagtggcatccgtggctacatg
aaggcggtggtgctggacctgctgagacgctacctgcaagtggagatgcagttccagcaa
gctcactatgacaagtgtgtcatcagtctgcgggagcagtacaaacccgacatgacccca
gtgctggagagcatcttctctcatgcccaggtggcaaagaagaacctgctggtgaccatg
ttaattgaccagctgtgcggccgggaacccacgctgacagatgagctgacagccatcctg
aacgagctgacgcagctcagtaagacagaacactccaaagtggcactgagagcccggcag
gttctcattgcctctcacctgccctcctatgagctgcggcacaaccaggtggagtccata
ttcctctctgctatcgacatgtatggacacgagttctgccctgaaaacctgaagaaactg
atcctctcagaaaccaccatcttcgacgtgcttccgttcttcttctaccatgacaaccag
gttgtgcgcatggcagcgctggaggtgtacgtgagacgtgggtatattgcctatgagctg
aacagcctgcagcatcggcagctctcggacggcacctgcctggtggagttccagttcatg
ctgcccttctcccacccaaataggatgtctgtccccatcagcatctccaaccccgacttg
gctcggcacagcactgagctcttcatggacagtggcttttcccccctgagccaacggatg
ggagccatggtggccttcaacaaatttgaggacttcacgaggaactttgatgaagtgatc
tcctgctttgctgagccacctttggagagctccctcttcagcgaggcacgagccaccatc
tatggggaggaggacgccaagaacatccgtgaggaaccaatccacatcctcaacatcgcg
ctccgccgggcggaccatgccgaggatgagaagctggtgcccatcttcagagcctttgcc
cagtccaagaaaaacatcctcgttgactgcgggctccgaagaatcacgtttctcattgcc
cagcagagagaattcccaaagtttttcacgttcagagccagggatgagtttgcagaggac
cgcatctaccggcacctggagccggcgctggccttccagctggagctgagccgcatgcgc
aactttgacctcacagccatcccctgtgccaaccacaagatgcacctctacctcggggca
gccaaggtgcaggcgggcaccgaggccaccgactatcgcttcttcatccgtgccattgtg
cggcactcagacctcatcaccaaggaggcctcctttgagtacctgcagaacgagggtgag
cgcctgctcctggaggcgatggatgagctggaggtggccttcaacaacaccagcgttcgc
accgactgcaaccacatcttcctcaactttgtccccaccgttgtcatggacccctccaag
atcgaggagtcggtacgggccatggtgatgcgctacggcagccgcctctggaagctgcgg
gtcctgcaggccgaggtgaagatcaacatccgcctgacgcccaccaccacggccatcccc
atccgcctctccctgaccaacgagtctggctactacctggacatcagcctctacaaggaa
gtgagggaccccagcaccggcaacatcatgttccagtcgtatggggacaagcaaggggcg
cagcatggcatgctcatcaataccccctatgtcaccaaggacctgctccaggccaagcgc
ttccaggcacagntcttgggcaccacctacgtgtatgacttcccggagatgatcaggcag
gctctcttcaagctgtggggctcctcagagctgcatcccaaggatgtcctgacatacaca
gagctggtgctggactcgcagggacagctggtgcagatgaacaggctccctggagggaat
gaggtggggatggttgccttcaaaatgaagctgaagacccctgagtacccaaagggccgg
gacatcatgctcatctgcaacgacatcacacacatgattggctcctttgggccagaggag
gacctggtgttcctgcgagcctcggagctggcacgggctgaaggcatcccacgtgtctac
attgctgccaacagcggtgcgcgtatcggctttgcagatgagataaagcacatgttccag
gtggcctgggtggaccctgaggacccctacaaggggttcaagtacctgtacctgaccccc
caggactacacgaggatcagtgccatgaactccgtgcactgtgagcacgtggaggaaggg
ggtgagtccaggtacgtcctattggacatcattgggaaggatcatggttttggggtggaa
aacctgcgagctgctggcaccatcgctggagagtccagtcgtgcttatgatgaaatagtg
accatcagcatggtgacgtgtcgtgccattgggatcggtgcgtacctggtgaggctgggc
cagcgtgtcatccaggtggagaactcccacatcatcctgactggggtcacagctctcaat
aaggtgttggggcgtgaagtttacacatccaataaccagctgggaggtgtgcaggtcatg
cacaacaatggtatttcccacatcactgtcccagatgactttgaaggagtctacaccatc
ctgcagtggctctcctacatgcccaaggataaccggagcccggtgcctgtcattgccata
agtgaccccatcgaaagagagattgattttgtcccttccaaagtcccctatgacccacgg
tggatgctggcagggagaccccatccaactctcaaggggacgtggcagagtggtttcttt
gaccagggaagcttcctggagatcatgaagccgtgggctcagacggttgtggttggcaga
gcgaggctgggaggtctccctgtgggcgtcattgctgtcgagacccgcactgtggaggtg
acaatacctgcagaccctgccaaccctgactcggaggcgaagataatccagcaggcagga
caggtctggtttccagactctgctttcaaaacagcccaggccattcgggacttcaaccgt
gagcacctcccactgatgatcttcgccaactggaggggtttctccagcggcatgaaagac
atgtatgacgaaatgctgaagttcggtgctttcatcgtcgatagcctgcgggattttaag
cagcccgtcctggtgtacatcccgccccacgccgagctgcggggaggctcctgggtggtc
atggaccccaccatcaaccccctgtatgtggagctctacgcggacaaggagagcaggggc
ggcattctggagcccgggggaacagtggagatcaagttcaggaagaaagatttggtgaag
accatgagaaggatcgataaggtttatgccaagcttgtggagcagctggggacacctgaa
ctgtctgaggggcagcgcaaggagctggagaagcagctcaaggcccgggaggagctcctg
ctgcccatatattaccaggtggccgtgcactttgctgacctgcatgacacccctggccgc
atgcaggagaaaggtgtcatcacggacatcctggagtggaagaacgcccgctcattcctc
tactggcggctgcgacggctgctgctggaagaggtggtgaagctggagatcctgaaagcc
aacagcgagctgagccacatccacatccagtccatgctgaggcgttggtttatggagaca
gaaggagctgagaaaggatacctctgggacaacaaccaggtggtggtggagtggctggag
aaacacatgcaggaggatgatggcagcaagtcagccatccgggagaacatcaagtacctg
aaaagggactacgtgctcaagcgcatccggagcctggtccaagccaaccccgaggtggcc
atggactgcatcatccagatggctcagcacatcacccgcgcgcagaaggctcaggttgcc
catctcctgtcaacggtggacagtgagagcccatcctga

DBGET integrated database retrieval system