KEGG   Gallus gallus (chicken): 430980
Entry
430980            CDS       T01006                                 

Gene name
GTF3C2
Definition
(RefSeq) general transcription factor 3C polypeptide 2
  KO
K15200  general transcription factor 3C polypeptide 2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gga03021]
    430980 (GTF3C2)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     430980 (GTF3C2)
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 430980
NCBI-ProteinID: XP_015140473
CGNC: 26860
Ensembl: ENSGALG00000031281
Position
3
AA seq 867 aa
MTSSPRAARRHVAGSGPGVERGRGRRRRGGGHAGGSGLSGPGAPPGLPRMASSAAGARGP
RCRERSRRGRGRGAPRELSSPAAPGEVAVKPRQRPVRSPKAPSGPQGPRPEEADGRGEAS
RSPEAEVLLRLSRGLQGPGGLRDGRDGPDTPPGGRPRRRAAKVALLYLQELAEELTSVCQ
PPAPTEGPQEPQRVQRKRRRKKEEEDANSDDPTQDADFVPSKDVLLQAEEEEESDAALSE
ESELEPLRGHSVRTSSGGRSKPLCRGVAPNGFHNSIMAPVEKCSSLTYSLREQVHSQWEF
PDWIPLAHNWMHLSESEAAPYLPVEEKSPLFCVQREGLEDGGALYRLNRFSSLQPHEERR
DAAFFVGGPIWAMEWCPTPEGAAAAQYVALYCHRTMEETHSVVGLHRGPALLQLWGLGTL
QEGSADRAGLAYAIAADHGCVWDMKFCPSGAWEPPGGSSKHPRMSRLGLLAAAFSDGSVV
LYALPHPGALQSCTRTQVKDGSPPKHVICKVRHTTALQVGSIQAGSAAECGQCFSLSWMP
SRPHQHLAAGFYDGTVAVWNLLTASPLQRVSHPDGSLQLYPFQCFLAHDHAVRSIEWCKA
NSNFLVTVGNDRKIKFWDLRRLYEPINSIKRFLSTEVAWLLPYNGVTVAQDNCYASYGLC
GIHYIDAGYLGYKAYFVAPRKGTVWSISGSDWLNTVAAGDITGELVAAVLPDLAVNPLNV
KRSSDRRFPVYKADLLPCSPAVPGSGEPVLPRTRHYSEMVATAYVRFRDTDLRSFKNFPS
REPMRRMHKQEGKAELSLDRLQLEALHKVRFSPNLEACGWLVSGGQAGIVRLHCLAGLAA
AVDPQLLPQSRARYSSHPGPPVSPPSE
NT seq 2604 nt   +upstreamnt  +downstreamnt
atgacgtcatctccgcgcgccgcgcgccgccatgttgcgggctccgggcccggcgttgag
cgcggccgtggccgacggcggaggggcgggggccatgcgggcggctccggcctgagcggc
ccgggagcgcctccgggactcccccgtatggcgtccagcgccgccggggcgcgcgggccg
cgctgccgcgagcggagccgccggggccgcggtcgcggcgctccccgggagctgtcatcg
cccgccgctccgggggaggtggcagtgaagccccggcaaaggcccgtccgcagcccgaag
gcgccgagcggccctcagggcccgcgcccggaggaggcggacgggcgtggggaggcctcg
cggagccccgaggccgaggtgctgctgcggctgtcccggggcctgcagggtcccgggggg
ctgcgggacggccgggatggccccgacacccccccgggaggacggccccggcggcgggcg
gccaaagtggcactgctgtacctccaggagctggcggaagagctgacgtctgtgtgccag
cccccagctcccaccgagggcccccaggagccccagcgtgtccagaggaagcgtcggagg
aagaaggaggaggaggatgccaacagcgatgaccccacccaggacgctgactttgtgccc
tctaaggatgtactgctgcaggcagaggaggaggaggaaagcgatgcagcactcagtgag
gagtctgaactggagccgctccgggggcacagcgtgaggacgtcgtcgggagggagatcc
aagcccttgtgccgcggtgttgctcccaatggcttccacaattccatcatggccccggtg
gagaagtgctccagcctcacctacagcctgcgggagcaggtgcactcgcagtgggaattc
cctgactggatccccttggcacacaactggatgcatctgtctgaaagcgaagctgcccca
tacctgccggtggaggagaagtctccgctcttctgcgtccagcgggagggccttgaggat
ggcggcgctttatacagattgaacagattcagctccctgcagccccacgaggagcgccgg
gacgcggccttctttgtgggtggccccatctgggccatggagtggtgcccgacgccggag
ggtgcagcggccgcgcagtacgtggctctgtactgccacagaaccatggaggagacgcac
agcgtggtggggctgcaccggggccccgcgctgctgcagctctggggcctgggcacgctg
caggagggctctgctgacagagctgggctggcgtacgccatcgctgctgaccacggctgc
gtctgggacatgaagttctgccccagcggcgcttgggagcctcctggtggctcctcaaag
cacccgcggatgagccggctcggcctcctggctgctgctttctcagatggcagcgtggtg
ctgtacgccctcccgcaccctggcgcgctgcagagctgcacgagaacccaggtaaaagat
gggtccccccccaagcacgtgatctgcaaggtgaggcacaccaccgcactgcaggtgggc
tccatccaggcggggagcgcggccgagtgcgggcagtgcttcagcctctcctggatgccc
tcccggccccaccagcacctggcggcggggttttatgatggcacggtggccgtctggaac
ctattgaccgcgtccccgctgcagcgcgtgtcccaccccgacggctctctccagctgtac
cctttccagtgcttcctggcccacgaccacgccgtgcggagcatcgagtggtgcaaagcc
aacagcaacttcctggtcacggtagggaacgaccgaaagatcaaattctgggacctgcga
cgcctctacgaacccatcaacagcatcaagcgtttcctcagcactgaggtggcttggctg
ctgccttacaacggtgtcaccgtggcccaggacaactgctatgcctcttacggtctctgt
gggatccactacatcgatgctgggtacctgggctacaaggcgtactttgtggctcctcgc
aaagggaccgtgtggagcatctcgggctcggactggctgaacacggtggctgctggggac
atcacaggcgagctggtggctgccgtgctgcccgacctggctgttaacccgctcaatgtc
aagcgctcctcggaccgcagatttccggtgtacaaagctgacctgctgccctgcagccct
gcagtgccagggagcggtgagccggtgctgcccaggacccggcactacagtgagatggtg
gccacagcctacgtgcggttccgggacaccgatctgcgcagcttcaagaacttccccagc
cgtgagcccatgcgccgcatgcacaaacaggaggggaaggcagagctgagccttgaccgc
ctgcagctggaagccctgcacaaggtgcgcttcagccccaacctggaggcgtgtggctgg
ctggtgtcggggggacaggcgggcatcgtgcgcctgcattgcctggcggggctggcagct
gctgtggacccgcagctgctgccgcagagccgcgcccgctacagctcccaccccggccct
cctgtgagccccccctccgagtaa

DBGET integrated database retrieval system