KEGG   Gallus gallus (chicken): 431212
Entry
431212            CDS       T01006                                 

Gene name
HOXD3
Definition
(RefSeq) homeobox protein Hox-D3
  KO
K09303  homeobox protein HoxA/B/D3
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    431212 (HOXD3)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Antp
    431212 (HOXD3)
SSDB
Motif
Pfam: DUF4074 Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 431212
NCBI-ProteinID: XP_015145072
CGNC: 16351
Ensembl: ENSGALG00000023420
UniProt: E1BZG3
Position
7
AA seq 413 aa
MIFEQGPRALAIAESKMQKTAYYDNAGLFGGYTYSKADAYPYGAAQQPYGAAGLDGEYPG
SACSVQGSAPGRGPAPKGPELGGSCMRTAGGGPGGSQPPGIGEQQPPALPPSSPPNPSSA
PPPKKAKGGPNASGSASATLSKQIFPWMKESRQNSKQKSTCPPSGESCEDKSPPGPASKR
VRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKAK
GIMHSPAGQSPERSPPLSGAAHAGYSGQLPAVGGLGYDAPSPTPFAKAQQSMYGLAAYTA
PLGGCLPQQKRYAGAEYEPHPLQSGGGFGNPGLQGSPVYVGGNFVDSMPASGPVFNLGHL
QHPSSASVDYSCAAQIPGGHHHGPCDPHPTYTDLSSHHASQGRLQEAPKLTHL
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgatctttgagcaggggccgcgggccttggcgatcgcagagagcaagatgcagaaaacc
gcctactacgacaacgcggggctcttcgggggctacacgtacagcaaggccgacgcctac
ccctacggcgcggcccagcagccctacggcgcggccggcctggacggcgagtaccccggc
tccgcctgctccgtgcaaggctccgcgcccggccgcggcccggcccccaagggccccgag
ctgggcggcagctgcatgcgaacggccgggggcggccccgggggcagccagcctcccggc
atcggcgagcagcagcccccggctctgccgccgtcctccccgcccaatccctccagcgcg
ccccccccgaaaaaagccaagggggggcccaacgcctccggctcggcctccgccaccctc
agcaagcagatattcccctggatgaaggagtcccggcagaactccaagcagaaaagcacc
tgccccccctcaggagagagctgcgaggacaagagcccccccggaccggcctccaagcgg
gtgcgcaccgcctacaccagcgcgcagctggtggagctggagaaggagttccacttcaac
cgctacctgtgccggccgcgccgcgtggagatggccaatctgctgaacctgaccgagcgg
cagatcaagatctggttccagaaccgccgcatgaagtacaaaaaggaccagaaagccaaa
ggcatcatgcactcccccgccggccagtccccggagcgcagccccccgctgagcggcgcg
gcccacgccggctactcggggcagctgcccgccgtcggcggcctgggctacgacgcgccg
tcgcccacgccgttcgccaaggcgcagcagagcatgtacgggctggccgcctacacggcg
ccgctgggcggctgcctgccgcagcagaagcgctacgcgggcgcggagtacgagccgcac
cccctgcagagcggcggcggcttcggcaaccccggcctgcagggcagccccgtctacgtc
gggggcaacttcgtggactcgatgccggcctcggggcccgtcttcaacctgggccacctg
cagcacccctcctccgccagcgtggactacagctgcgccgcgcagatccccggcggccac
caccacggaccttgcgacccccaccccacctacacggacctctcctcgcaccacgcgtct
cagggacggctgcaggaggcccccaagctcacgcacctgtag

DBGET integrated database retrieval system