KEGG   Gallus gallus (chicken): 431235Help
Entry
431235            CDS       T01006                                 

Gene name
CTRB2
Definition
(RefSeq) chymotrypsinogen 2-like precursor
  KO
K01310  chymotrypsin [EC:3.4.21.1]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     431235 (CTRB2)
Peptidases [BR:gga01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   431235 (CTRB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986 DUF316
Motif
Other DBs
NCBI-GeneID: 431235
NCBI-ProteinID: NP_001264565
CGNC: 54168
Ensembl: ENSGALG00000000038
UniProt: H9KYN7
Position
11
AA seq 269 aa AA seqDB search
MALLWLLGCLVLAGSARATRSLPSCGVPAITPVIRGYNRIVNGEPAVPGSWPWQVSLQRY
GNFHFCGGSLISEQWVVTAAHCGVRTTDTVVLGEYDQETASSDVQRLGIAKVFRNPSYSS
LTIRNDITLIKLATPAQLNARVAPVCLPQATDDFPGGLTCVTTGWGLLNSNDENTPAILQ
QAALPLLTNAQCKQYWGFRIYDVMVCAGADGSSSCMGDSGGPLVCQKDGAWTLVGIVSWG
SSTCSTSTPGVYARVTKLREWIDSVLAAN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggctctgctgtggctgctgggctgcctggtgctggcgggctctgcccgtgccacccgc
tctttgccgagctgcggtgtgcccgccatcacgcccgtcatccgtggctacaaccgcatc
gtgaacggggagccggcggtgcccgggtcctggccctggcaggtgtccctgcagcgctac
ggcaacttccacttctgcggcgggtcgctgatcagcgagcaatgggtggtcactgctgcc
cactgcggggtcaggaccaccgacaccgtggtgctgggcgagtacgaccaggagacggcc
tccagtgacgtgcagaggttgggcatcgccaaggtcttccggaaccccagctacagctcg
ctgaccatccgcaacgacatcacgctgatcaagctggccaccccagcacagctgaacgcc
cgcgtggcgcccgtctgcctgccccaggccaccgacgacttccccgggggcctgacctgc
gtcaccacgggctgggggctcctcaactccaacgatgagaacacgccggccatcctgcag
caagcggcccttcccctgctcaccaacgcgcagtgcaagcagtactggggcttccgcatc
tacgacgtgatggtgtgcgccggggccgacggatcctcctcctgcatgggcgactccggg
ggcccgctggtgtgccagaaggacggcgcctggacgctggtgggcatcgtctcgtggggc
agcagcacctgctccacctctacgcctggtgtgtacgcccgtgtcaccaagctccgcgaa
tggatcgactccgtgctggcggccaactga

DBGET integrated database retrieval system