KEGG   Gallus gallus (chicken): 431331
Entry
431331            CDS       T01006                                 

Gene name
LZTS1
Definition
(RefSeq) leucine zipper putative tumor suppressor 1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Fez1 PEARLI-4 HalX ABC_tran_CTD Atg14 UPF0242 Spc7 CENP-F_leu_zip
Other DBs
NCBI-GeneID: 431331
NCBI-ProteinID: XP_428882
CGNC: 1212
Ensembl: ENSGALG00000001727
UniProt: F1NI59
Position
22
AA seq 604 aa
MGSVSSLISGHSFHSKHCRASQYKLRKSSHLKKLNRYSDGLLRFGFSQESGHKSGSKSSK
NEDFFYIKVSQKAPGPHRTDYTALGSTELGQAGSSGVDFGTPTPQKLMPFPSQLEVGVEK
PTARPTAFKPVLPRSGAVLHSSPENGAHLPTQLHPLDKGKEQELKPVLCSGGLSDSGRNS
MSSLPTHSTSSSYQLDPIVTPVGPISRFGGSAHNIMQCAIIQDSNMMSLKAMSFSDGGNK
ILNPGKAPQHRAAEKTACIRSPISTDESTIQELEQKLLEREGELQELQLSFEEKEASSCQ
VYEEKQRRCKEELEGLKQRCNSKLKQSSQKTQRTQQVLQLQVFQLQQEKQQLREELENLM
KEQNLLETKLRSYEKEKTSFAPALEETQWEVCQKSGEISLLKQQLKESQTELTTKTTEIL
SLKAQLKDVRAKMEGLEMKTQDLEGSLRTKAMELEVCENELQRKKNESELLREKVNLLEQ
EIVELRAEMAVLRAQLSDATRPSEVQALQGEVERLRAELQAERDSNEQMSSSFQQERQTW
REEKEKVIHYQKQLQQSYLHMYKRNQNLEKMLQQLAAGEDGKEPIELDIPGADMPYEDII
ATEI
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgggcagtgtcagtagtctcatttctggccacagcttccacagcaagcactgccgcgcc
tcgcagtacaagcttcgtaagtcgtcccatctgaagaagctcaacaggtactcggacggg
ctgctccgcttcggcttctcccaggaatccggccacaaatcgggctccaaaagcagcaag
aatgaggacttcttttacatcaaggtcagccagaaggcgcccggcccccatcgcacggac
tacacggcgctgggcagcacagagctgggccaggctgggagcagcggggtggacttcggg
acacccacaccgcagaagctgatgcctttccccagccagctggaagtgggtgtggagaag
cccacggcacgacccaccgccttcaagccagtactgccccgctccggtgccgtcctccac
tcatccccagagaatggagctcacctccccacacagcttcaccccctggacaaaggcaag
gagcaggagctgaagccggtgctgtgctcaggagggctgtctgactcaggcaggaactcc
atgtccagcctgcccacccacagcaccagcagcagctatcagctggaccccatcgtcacc
cccgtggggcccatcagccgcttcgggggctctgcacacaacatcatgcagtgtgccatc
atccaggacagcaacatgatgagcctcaaggccatgtccttctccgacggcggcaacaag
atcctcaaccctggcaaagccccccagcaccgcgccgccgagaagaccgcatgcatccgc
tctcccatctccactgatgagtccactatccaggagctggagcagaagctgctggagaga
gagggagagctgcaggagctgcagctgagcttcgaggagaaggaagccagctcctgccag
gtgtatgaggagaagcagcggcgctgcaaggaggagctggaggggctcaagcagaggtgc
aacagcaagctgaagcagagctcacagaaaacccagcgcacgcagcaggtcctccagctc
caggtgttccagctgcagcaggagaagcagcagctgcgggaggagctggagaacctcatg
aaggagcagaatttgctggagaccaagctgaggtcctacgagaaggagaagactagcttt
gcaccagcactggaggagacccaatgggaggtgtgccagaagtcaggggagatctccctc
ctgaagcagcagctgaaggagtcccagaccgagctcaccaccaagaccactgagatcctc
agcctgaaggcacagctgaaggacgtgagggccaagatggaagggctggagatgaagacc
caggacctggagggctccctgcgcaccaaagccatggagctggaggtgtgtgagaacgag
ctgcagcgcaagaagaacgagtctgagctgctgagggagaaggtcaacctgttagagcag
gagatagtggagctgcgggcagagatggccgtgctccgggcacagctgagcgatgccacc
cggcccagtgaggtgcaggcactgcagggtgaggtggagaggctgcgggctgagctgcaa
gctgagcgggacagcaacgagcagatgagctccagcttccagcaggagaggcagacatgg
agggaggagaaggagaaggtgatccactaccagaagcagttgcagcagagctacctgcac
atgtacaagaggaaccagaacctggagaagatgctgcagcagctcgcggcgggggaggat
ggcaaggagcccattgagctggacatcccaggggctgacatgccctatgaggacatcatt
gccactgagatctga

DBGET integrated database retrieval system