KEGG   Gallus gallus (chicken): 431414
Entry
431414            CDS       T01006                                 

Gene name
LBX2
Definition
(RefSeq) transcription factor LBX2
  KO
K09353  homeobox protein LBX
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    431414 (LBX2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, NK-2
    431414 (LBX2)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN Homez
Other DBs
NCBI-GeneID: 431414
NCBI-ProteinID: NP_001038133
CGNC: 54237
UniProt: Q29ZM6
Position
4
AA seq 213 aa
MTSAREAAATPPLPEERRRAALEQLPPPAHCNKPLTPFGIEDILARPSPPAHGAPPARIP
EKAAGPAPPRTAPSSPLCALEELASKTFRGLELSALRAAAGRDPLSALAQRPTSKKRRKS
RTAFSNQQLFELERRFVRQKYLSPADRDQLAQRLALSSAQVITWFQNRRAKLKRDLDEMR
ADVASLQALRLREPPPAPPGPAELSEEEIDVGA
NT seq 642 nt   +upstreamnt  +downstreamnt
atgacctcggcgcgggaggcggccgcgacccccccgctgcccgaggagcgccgccgggcc
gcgctggagcagctgccgccgcccgcgcactgcaacaaaccgctgacgccgttcggcatc
gaggacatcctcgcgcggccctccccccccgcgcacggcgctcccccggcccggatcccg
gagaaggcggcgggacccgcaccgccccgcaccgccccgtcttcgccgctgtgcgcgctg
gaggagctcgccagtaagacgttccgcgggctggagctgagcgcgctgcgggcggccgca
ggtcgggaccctctgagcgccctcgcgcagcgcccgacgtcgaagaagcggcgcaaatcg
cgcacggcgttcagcaatcagcagctcttcgagttggagcgccgcttcgtgcgccagaag
tatttgtcccccgccgaccgcgaccaactggcgcagcgcctggcgctcagctccgcgcag
gtcatcacctggttccagaaccgccgcgctaagctcaagcgcgacctggacgagatgcgc
gccgacgtggcctctctgcaggcgctgcggctgcgggagccccccccggccccccccggc
cccgccgagctgtccgaggaggagatcgacgtgggggcctga

DBGET integrated database retrieval system