KEGG   Gallus gallus (chicken): 431596
Entry
431596            CDS       T01006                                 

Gene name
ANKDD1B
Definition
(RefSeq) ankyrin repeat and death domain-containing protein 1B isoform X3
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank_3 Ank Death DUF249
Other DBs
NCBI-GeneID: 431596
NCBI-ProteinID: XP_004937398
CGNC: 54292
Ensembl: ENSGALG00000014958
Position
Z
AA seq 503 aa
MGPLPAGGEEEELAATMKGLSNLFRVREDTTHGDAAANHNSLLPDEREFQHAAKMNNLET
MEKLFKKNLNINAVDTLKRTALHFAVARSHTSAVDFLLHHKARVDMADQHGLTVIHLAAW
TGNLDIMRKLVKAGADQRAKNEEGMNALHFAAQNNSVKIIDYFLQDLHLTDLNKPDGKGR
KPFLLAAERGHADMINNLIALNLFTTEKDKEGNTALHLAAKNGHSEAVKILLKYWDEIND
LNENGETPFYLSVEEGNEKCAELLLEAGSNIDVLTHNNSNALQAAIQNGHQSLVTFLIDK
NIDLVPKPERQETPLHLAADLGNVEMVEVLLKAGCDLKITDRHGKTALAVASRSNYALIV
DMIIKAERHYAMEQAHLGHSDGWSDSDLSFKQDHSAQTKQLRSSLWNLAYNHLKPQEWKI
LALFWKFTDEQIKAIEEQWTGKKSYKEHGHRMLLIWLHGTLLARQNPVKHIFEDLVKAGF
QHLAEKIRTESSTDTESRKCKIS
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggggccccttcctgcaggtggggaggaagaggagctggcagccacaatgaagggactg
agcaacctgtttcgtgtcagagaggacacaacgcatggagatgcggcagccaaccacaac
agtttattgccagatgagagagaattccaacatgcggctaagatgaacaatttggaaacc
atggaaaagctgttcaagaagaatcttaatataaacgctgtggacactttgaagcgcact
gcgctgcattttgctgttgcaagaagtcatacgtctgcagtggattttctgctccatcac
aaagctagagttgatatggcagatcagcatggcctgacagtgatccatcttgcagcttgg
actggaaatctagatataatgaggaaattagttaaagctggcgctgatcaaagggctaag
aatgaggaaggaatgaatgcactgcactttgcagcacagaacaacagtgttaaaataatt
gattattttctccaagaccttcacttgactgacttgaacaagcctgatgggaaaggcaga
aagccatttcttctggcagcagaaagaggccacgctgacatgataaataatctgatagct
ctaaatctgtttacgactgaaaaagataaggagggaaacacagccctacatctggcagct
aaaaatggccacagtgaagccgtaaagattctgctcaaatactgggatgaaataaatgac
ctcaatgagaatggagaaactccattttacttgtctgtcgaagagggtaatgaaaaatgt
gccgaactcctcctggaagcagggagtaacatcgatgttttaactcacaacaacagcaat
gcattgcaagctgccattcagaacggacatcaatccttggtcacttttcttattgataag
aacattgacctggtccctaaacccgagaggcaggaaactcccctacatctggctgctgat
cttggcaatgtggagatggtggaagtgctgctgaaggcaggttgtgacctcaagatcaca
gacaggcatggaaaaactgcacttgccgtggcttcaaggagcaattacgccctcattgta
gatatgatcattaaagcagaaaggcattatgccatggaacaggcacatctgggtcatagt
gatggttggtcagactctgatttgtccttcaaacaagatcatagtgcacagaccaagcaa
ctccgttcctccctgtggaatctggcgtacaatcatttaaaaccccaggaatggaaaata
ctggccctgttctggaagttcacagatgagcagattaaagctattgaggaacaatggaca
gggaaaaagagttataaggaacacggccacagaatgctgctgatctggttacatggtact
ttgctggcccgtcagaatcctgtcaagcatatattcgaagacttggtgaaagcaggattt
cagcatttagctgaaaagatcagaactgaaagtagcactgacacagagtccagaaaatgc
aaaatttcatga

DBGET integrated database retrieval system