KEGG   Gallus gallus (chicken): 431603
Entry
431603            CDS       T01006                                 

Gene name
ADAMTSL1
Definition
(RefSeq) ADAMTS-like protein 1 isoform X1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: TSP1_ADAMTS Ig_3 I-set TSP_1 Ig_2 ig TSP1_CCN V-set PLAC TSP1_spondin ADAM_spacer1
Other DBs
NCBI-GeneID: 431603
NCBI-ProteinID: XP_004949181
CGNC: 66593
UniProt: A0A3Q3AX29
Position
Z
AA seq 1810 aa
MAAAAGQRRGTAAPLLALALGLLAAAAQVCGDQSQGAVFLREFTLIRRESLHDDFLSDLL
NNHRTEDPSSRTARSEEDRDSLWDAWGSWSECSRTCGGGASYSLRRCLSSKTCEGRNIRY
KTCSNVDCPPEAGDFRAQQCSAHNDVKYQGQFYEWLPVSNDPDNPCSLKCQARGAALVVE
LAPKVLDGTRCYTESLDMCISGLCQIVGCDRQLGSTVKEDNCGVCNGDGSTCRLVRGQYK
SQLSANKMVDTVVAIPYGSRHIRLVLKGPDHLYLETKTLQGVKGENNLSSTGSFVVDNSS
IDFQKFPDKEILKIAGPLTADFTVKIVYAGAADSSVQFIFYQPIIHRWRETDFFPCSASC
GGGYQLTSAECFDLRSNRVVADQYCHYYPENIKPKPKLQECNLDPCPASDGYKQIMPYDL
YHPLPRWESTPWTACSSSCGGGIQSRSVSCVEEDIQGHISPVEEWKCMYTPKMPVVQPCN
IFDCPKWLAQEWSPCTVTCGQGLRYRVVLCIDHRGMHTGGCSSKTKPHIKEECIVPTPCY
KPKEKLPVEAKLPWYKQAQELEEGAVVSEEPSFIPEAWSSCSVTCGVGSQVRLVKCQVLL
SFSQSVADLPIDECEGPKPVSQRACYSGPCSGEAAEYTPEETDLLYGRLQEFDELYDWEY
ESFTECSESCGGGVQEAVVTCLNKQTRETADETHCVTSRRPPQLLKACSLDPCPPRWEIG
KWNTCSLTCGVGLQTRDVFCSHLLSRESNETVILADELCHKPKPSLVQACNRFDCPPSWY
TTEWQECSQTCGGGVQKRDILCKQRLADGSLLELPETFCSMPKLVSQQTCKNEDCPNEWL
LSDWSQCSVSCGEGTQSRNAICRKMLKTGGSIIINSSLCPPLPFSSLLRPCALATCARHN
RPAHKQSPHIMAVKKVYIQTRKQKKLHFIVGGYAYLLPKTSVILRCPTRRFRKSLIFWEK
DNKRLISSAHITIAPYGYMKIHRLKPSDTGIYTCIAGPAQEHFVIKLIGSNKNLITGQPA
GIREEEAMRKASLNEALRTQEKHVNGILFNGSKTEKRGHLTDPSGWYDSIVSKLLQHRGW
PGENLEFWEAQESTERNVSSEEDQSQEYSLPFTMVTEQKRLDDIIRNLSQQPEELKDIYT
EQLVVQLAHEIFKSHLEHQESVLKASRRRVDAASMEYPFHRHVSGFTSSLRTSSAEAFLP
TSMNPTNGLHSPHQKPAILRKISAAQQLSASEVVTHLGQTVVLASGTLSVLLHCEAVGNP
KPTITWAKNGEEVKYNDRMLLQPDDSLQILAPVEADVGFYVCNASNALGSDSVSIAVTLA
GKPLIKASRATVINTELPAVTADIGSTVKTVQRTNVTISCQVAGVPEAEVTWFKNKVKLS
PAHHLRDGLLLIANVSLSDQGLYSCRAANLRGEVTESSQLLVLEPPRPLPYLENLTAVLS
SIGTSPPSVLTSPSGTKMTISPGSSALIGCAVDGHPTPNITWLYSGKPLSLRHRFLAAGR
ILQILNISDAPEGEFSCLAQNEAGSLLQKTSLAIQDYQWSVDKLMACSASCGHKGVQLPQ
LRCLLDGIEVNISNCKERPKPTLQPIACNRRDCPSRWMVTSWSLCTRSCGGGIQMRRVTC
QRLTAKGSSVPMSNEACAQASKRPVDTQHCNRQPCVEWVASSWGQCNGPCIGPRLAVQHR
QIFCQTKDGTSVSSDQCSALPRPLSTQNCWTDICGVHWRVSLWTVCTATCGNYGFQSRRV
DCVHIRTNKPVLEHYCSWRPRPVNWQRCNITPCENMECRDTTRYCEKVKQLKLCQLTQFK
SRCCGTCGKA
NT seq 5433 nt   +upstreamnt  +downstreamnt
atggccgcggcggcggggcagcgccggggaacagccgcccctttactcgccctcgccctg
gggctcctcgccgccgcagcgcaggtttgtggagaccaaagccaaggagcagttttccta
cgtgaatttacattgattcggagagaaagtctacatgatgatttcctgtctgatttgctg
aataaccacagaacagaagatccgagctccagaacagctcgctcggaggaagatcgagac
tcactgtgggatgcctggggttcgtggagtgaatgttcacgcacatgtggaggaggggct
tcatattcactgagacgttgcctgagcagcaagacctgtgaagggcgaaacatccgatac
aagacatgcagcaatgtggactgtcctccagaagcaggtgattttcgtgctcagcagtgc
tcagctcataacgatgtcaagtatcagggacagttttacgagtggcttcctgtctctaac
gatcctgacaacccatgctcgctgaagtgccaggccagaggagcagctttggttgtagag
ctggcaccaaaggttctggatgggacacgatgctacactgaatccctggatatgtgcatc
agcggcttgtgccaaattgttggctgtgaccgccagctgggaagcaccgtcaaagaagat
aactgtggggtctgcaatggtgatgggtccacctgccggctggttcgaggccagtataag
tcccagctctcagcaaataaaatggttgatacagtggttgctattccctatggaagcaga
catattcgcctcgtgctgaaaggacccgatcatttatatttggaaaccaagactctccaa
ggtgtaaagggtgaaaacaacctcagctccacgggttccttcgttgtggacaattctagc
attgacttccagaagtttccagacaaggagatactgaaaatagctgggcctctcactgca
gacttcactgtcaagatcgtctacgctggtgctgctgacagttcggtccagtttatcttc
tatcagcctatcattcatcgatggagagaaactgattttttcccttgttcagcatcctgt
ggaggaggttatcaactgacttctgctgaatgttttgatctgaggagcaatcgggtagta
gcagatcaatactgtcactattaccctgaaaatatcaagccaaagccaaaacttcaggag
tgtaatctggatccttgtcctgcaagtgatggatacaagcagatcatgccctatgacctc
taccatccccttcctcgatgggaaagtacaccctggactgcctgctcctcatcctgtgga
gggggcattcaaagccgcagtgtctcatgtgtggaggaagacattcaagggcatattagc
cccgtggaagaatggaaatgcatgtatactccaaagatgcctgttgtccaaccttgcaat
atatttgactgcccaaagtggcttgctcaggaatggtcaccgtgcactgtgacctgtgga
caagggctcagatatcgtgtggtcctttgcattgatcacagggggatgcatacaggaggc
tgtagctctaaaacaaagccacacataaaagaagaatgcatcgtacccactccttgttac
aaacccaaagagaaacttcctgtggaagcaaagttgccgtggtacaaacaagctcaagag
ctggaagaaggagcagtggtgtctgaagaaccttcgtttattcctgaggcttggtcctcc
tgtagtgtcacatgtggagtgggcagccaggtgcgccttgtgaaatgtcaagtgcttctg
tctttctctcagtctgtggctgacttgcccattgatgaatgtgaaggtcccaaacctgtg
tctcagagagcctgttacagtggcccctgcagtggagaagcagccgaatatacacctgaa
gaaacggatctgctgtatggtagattgcaggaattcgatgagctctatgactgggaatat
gagagcttcactgagtgttcagagtcttgtggaggaggtgtccaggaggctgtggtgacc
tgtctgaacaagcaaaccagggagactgcagatgagacacactgtgtaacaagccgccgt
cctccacagctgctgaaagcctgtagtctggacccctgccctccaagatgggaaattggg
aaatggaacacctgcagtcttacgtgtggggtcggattgcagacacgagatgtcttctgt
tctcacttgctatcaagagaaagtaatgagaccgtgatcttagcagatgaattgtgccat
aaacctaagccatcgcttgtacaagcctgtaatcgctttgactgcccaccctcctggtac
actacagaatggcaagagtgctcgcagacatgtggaggcggtgtccagaagcgagacata
ctttgcaagcagcgcctggcagatggaagcttgttagagctgccagaaaccttctgctcc
atgccaaagctggtttcccaacaaacctgcaaaaatgaggactgtcctaatgagtggctt
ctttctgactggtcacagtgttcggtgagttgtggagaggggacccagagtcgaaatgct
atttgcagaaagatgctgaaaactgggggttccatcatcatcaattcctccctgtgccca
cctctgccattctcatccttgctcaggccgtgtgcactagcaacctgtgcaaggcacaac
aggccagctcataagcaaagtcctcatattatggctgtaaagaaagtttacatccagaca
aggaagcagaagaagctacactttattgtgggtgggtatgcctacctgctgcccaaaacc
tccgttattctccgatgccccacaaggaggttccggaagtcactgatcttctgggaaaag
gataacaagaggctcatcagctcagctcacatcaccattgcaccctatgggtacatgaaa
atccatcgtttgaaaccttcagacactgggatatatacctgcatagcagggccagcccag
gagcatttcgtaattaaactaataggaagcaacaaaaatctcattactgggcagccagct
ggcattagggaggaagaggccatgagaaaggccagcctaaatgaagccttgcgaacacag
gagaaacatgtcaatgggattctcttcaatgggagcaagactgaaaagagagggcatctc
actgaccctagtggctggtatgacagtattgtctcaaagctgctacagcacaggggctgg
ccaggggaaaatctggagttctgggaagcccaggagtccacagagagaaatgtgtcctca
gaggaagaccagagccaggagtatagcctgccatttactatggtcacagagcagaaacgg
ttggatgatatcataagaaatttgtctcagcaacctgaggagcttaaagatatttacact
gagcagcttgttgtacagctggctcatgagattttcaagagccacttggagcatcaggaa
tctgtcctcaaagcatcaagacgaagagttgatgcagcttccatggaataccctttccac
agacatgtttctggatttaccagctccctgaggacatcatctgctgaagcatttcttccc
acctctatgaacccaacaaatggcttacacagccctcatcaaaagcctgccatcctccga
aagatttcagcagcacaacagctttctgcttcagaggttgtcacccacctgggacagaca
gtggtcctagccagtggcacactgagtgtgctgcttcactgcgaagcagtgggaaaccca
aagcccaccatcacctgggctaagaatggagaggaggtgaaatacaatgataggatgcta
cttcagcctgatgactccttgcagattctagcccccgtggaagctgatgtgggtttctat
gtttgcaacgcatctaatgctctgggttctgattctgtgtccattgctgtcactctagca
ggaaagccactaataaaggcatcaagagctactgtgatcaacacagaattgcctgctgtc
actgctgatattggaagcacagtgaaaacagtccagagaactaatgttaccattagctgc
caggttgcaggtgttcctgaagcggaagttacttggtttaaaaataaggtcaagctgtcc
cctgctcaccacctgcgtgatgggttgttgctaattgcaaatgtttccctgtcggatcag
gggttatattcctgcagggcagccaatctacgtggggaggtaactgaaagctcccagctg
ttggttcttgagcctccacgaccccttccttacctagaaaacttgacagcagtgctttcc
agcattgggaccagccctccttcagtgttgacctctccttcaggaacaaaaatgactatc
agtccagggagctctgctctaataggttgcgctgtggatggccatccaactccaaatatc
acctggctttactctggaaagcctctcagtctgaggcatcgcttcctagcagcaggacga
attcttcagatactgaacatcagtgatgctcctgaaggagaattcagctgccttgctcag
aatgaggctggttcgctcttacaaaaaacttccctggcaatacaagactaccagtggtca
gtggacaagctgatggcttgttctgcttcctgtggccacaaaggagtgcagctgccccaa
ctgaggtgcttactggatgggattgaagtcaatatatccaactgcaaagagaggcccaag
ccaaccctgcagcccatcgcatgcaataggagggactgcccttcacggtggatggtaaca
tcatggtctctatgtacacggagctgcggtggaggaatccaaatgcgacgagtgacatgc
caacgactgacagcaaaaggcagctctgtcccaatgtcaaatgaagcctgtgctcaagcg
tccaagcgccctgtggacacacagcactgtaacaggcaaccctgtgttgagtgggtggcc
tcctcctggggccagtgtaatgggccttgcattgggccacgacttgctgtacaacacaga
cagatattttgccagacaaaagatgggacttctgtgtcatctgatcagtgcagtgcctta
ccgaggcctttgagcactcagaactgctggaccgacatctgtggtgtgcactggagggtc
agcttgtggacagtgtgtacagctacctgcggaaactatggcttccagtcccggcgtgtg
gactgtgtgcacatccgtaccaacaagcctgtgctcgagcactactgctcctggagaccg
cggccggtcaactggcagcgctgcaacatcacgccctgtgagaacatggagtgcagagac
accacaaggtactgtgagaaagtgaagcagctcaaactctgccagctcacccagttcaaa
tcacgctgctgcgggacgtgtggaaaagcttga

DBGET integrated database retrieval system