KEGG   Gallus gallus (chicken): 431604
Entry
431604            CDS       T01006                                 

Gene name
BNC2
Definition
(RefSeq) zinc finger protein basonuclin-2 isoform X1
  KO
K24146  zinc finger protein basonuclin
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    431604 (BNC2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    431604 (BNC2)
SSDB
Motif
Pfam: zf-C2H2 zf-met zf-C2H2_4 zf-C2H2_jaz zf-C2H2_aberr
Other DBs
NCBI-GeneID: 431604
NCBI-ProteinID: XP_015135686
CGNC: 54294
Ensembl: ENSGALG00000015101
Position
Z
AA seq 1062 aa
MSFFPSLSEEAEVDVRDRHTQRHRERKRARDLTLRDSCTDNSMQFGTRTAATDSGFMGTW
QNTDTNLLFRMSQQAIRCTLVNCTCECFQPGKINLRTCDQCKHGWVAHALDKLSTQHLYH
PTQVEIVQSNVVFDISSLMLYGTQAVPVRLKILLDRLFSVLKQEEVLHILHGLGWTLRDY
VRGYILQDAAGKVLDRWAIMSREEEIITLQQFLRFGETKSIVELMAIQEKEGQAVAVPSS
KTDSDIRTFIESNNRTRSPSLLAHLENSNPSSIHHFENIPNSLAFLLPFQYINPVSAPLL
GLPPNGLLLEQPAMRLREPSLTAQNEYNESSESEVSPTPFKNEQTSSRNALTSITNVEPK
TEPPCVSPVQTPTPVNDLSKTEHTKSSFRIHRMRRMGSASRKGRVFCNACGKTFYDKGTL
KIHYNAVHLKIKHRCTIEGCNMVFSSLRSRNRHSANPNPRLHMPMLRNNRDKDLIRATSG
AATPVIASTKSNLTLTSPGRPPMGFTTPPLDPVLQNPLPSQLVFPALKTVQPVPPFYRNL
LTPGEMVSPPTSLPTSPIIPAASGMEQHPPPPSESSVPSVLMPTSEPNADLAPKKKPRKS
SMPVKIEKEVIDTADEFDDEDEEVNDSSTMVNDIGHDNHCHSQEEMSPGLSVKDFSKTDR
SRCISRPDIRRADSMTSEDQEHERDYENESESSEPKLCEESMEGDDRLHEPVEKSMMHSD
RPDENHNDSSNQDVIKVKEEYTDPTYDMFYMSQYGLYNGGSASMAALHESFASTFNYNSP
QKFSPEGEMCSSPDPKICYVCKKSFKSSYSVKLHYRNVHLKEMHVCTVAGCNAAFPSRRS
RDRHSANINLHRKLLTKELDDMGLDSSQPSLSKDLRDEFLVKIYGAQHQMGLDIREDTSS
PAGTEDSHMNGYGRVMSEDYMVLDLSTTSSIQSSSSIHSSRESDAGSDEGILLDDVDGAS
DSGESAHKADAPALAVGMGTDVPGSLMFNSVSVSNGGIMCNICHKMYSNKGTLRVHYKTV
HLREMHKCKVPGCNMMFSSVRSRNRHSQNPNLHKNIPFTSVD
NT seq 3189 nt   +upstreamnt  +downstreamnt
atgtcttttttcccctctttgtcagaagaggcagaagtggatgtgagagacagacacaca
cagagacacagagagcgaaagagggcaagagacttgactttaagagactcctgcactgac
aactccatgcagttcggaacaagaacggcagcgaccgactctggtttcatggggacatgg
cagaacactgacactaacctcctgttcagaatgtcccaacaggccatccgctgtacactg
gtaaattgcacatgtgaatgttttcagccagggaagattaacctgagaacctgtgatcag
tgtaaacatggctgggtggcacatgccttggacaagcttagtactcagcacctctaccac
ccaacccaagtggagatcgtgcagtccaatgttgtatttgacatcagcagcctgatgctt
tacggtacccaggctgtgcctgtgagactgaagatactacttgaccgactcttcagtgta
ctgaagcaagaggaggtgttgcatattctacatggcttaggctggacacttcgagactat
gttcgaggctacatccttcaggatgctgcaggcaaggtgctggaccgctgggccataatg
tccagggaagaagagatcattacccttcagcagttcttgagatttggagaaaccaaatcc
attgtggagctgatggcaattcaagaaaaagaagggcaggctgtggctgtgccatcttca
aagacagattcagatataaggacttttattgaaagcaataatcgcaccaggagcccgagt
ctccttgctcacttggagaatagcaacccttccagcattcatcattttgaaaacatcccg
aatagtcttgcattcctgctaccattccagtacataaatccagtctctgctcctctgctg
gggctgcctccaaatggcctcctgctggaacagccagcaatgaggcttcgtgaaccaagc
cttacagctcaaaatgaatataatgagagcagtgaatctgaagtttcgcctacacctttc
aagaatgagcagacgtccagcagaaatgctttgaccagcatcacaaatgttgaacccaaa
actgagccaccctgcgtctctcctgttcagacacctacacctgtcaatgatttatcgaaa
acggaacatactaaaagttcattccgcattcacagaatgaggagaatggggtctgcctct
agaaaaggaagagtgttttgtaatgcatgtggcaaaactttctatgacaaaggtacgctt
aaaatccactacaatgccgttcacctgaagatcaagcaccggtgcactattgagggctgc
aacatggtattcagctctctcagaagccgcaatcgtcacagtgctaaccccaacccccgc
ctccacatgcctatgctaagaaataaccgagacaaagatctaattcgtgctacatcaggt
gctgccaccccagtcatagcaagtacaaaatccaacctaactttaacaagccctgggcgt
ccaccgatgggatttaccactcctcctctagatcctgtactacagaatcctcttcccagt
cagctggtgtttccagctttaaagactgttcaacctgttcctcctttttacagaaattta
cttactcctggagaaatggtgagtcctccaacctccctccctaccagtccaataatacca
gcagcaagtggcatggagcagcatccccctcctccttcagagtcatcagtaccatcagtg
ctgatgcccacctcagagcctaatgctgaccttgcccctaagaagaagccaaggaagtcg
agcatgccagttaaaatagaaaaggaagttattgatactgccgatgaatttgatgatgaa
gatgaagaggtgaatgacagcagcacaatggtaaatgacattggtcatgacaatcactgc
cattctcaggaagaaatgagcccaggcttgtctgtgaaagacttttccaaaactgacaga
agcagatgcatttccagaccagatataagaagggcagacagtatgacatcagaagaccag
gagcacgagagagactatgaaaatgagtctgagtcttcagagccaaaactgtgtgaagaa
tccatggaaggtgatgaccgcctccatgaacctgttgaaaaatctatgatgcacagtgac
agaccagatgaaaaccacaatgactcttctaaccaggatgtcattaaggtgaaggaagag
tatacagaccctacatatgatatgttctacatgagccaatatggactgtacaacggagga
agtgccagtatggctgcccttcatgaaagttttgcttccacattcaactacaacagccct
cagaagttctccccagaaggtgaaatgtgctcaagcccagaccccaagatctgctacgtg
tgcaagaagagtttcaagagttcctacagtgtgaaacttcactacagaaatgttcattta
aaagagatgcatgtctgcacggtggctggctgtaatgctgcgttcccatcacggagaagc
agagacagacacagtgctaatataaacctgcaccgtaaactgttgaccaaagaactggat
gacatgggcctggactcctcacagccttctcttagtaaggaccttcgcgatgaatttttg
gtgaagatatatggcgctcagcatcagatggggcttgacataagggaagacacctcctcg
cctgctggtactgaggattcccatatgaatgggtacggcagggtcatgtcagaagactat
atggttctagacctgagcaccacctccagcatccagtccagcagcagtatccattcctca
agagaatctgatgcaggaagtgatgagggcattctcctggatgacgtcgatggggcaagt
gacagcggggaatctgcccacaaagcagatgcccctgccttagctgtaggtatgggcact
gatgtcccaggatccctcatgttcaacagtgtttcggtgagcaacggtgggataatgtgt
aacatttgccacaaaatgtacagcaacaagggaaccctcagagtgcactataaaacagtg
cacttgcgagagatgcacaaatgcaaagtccctgggtgcaacatgatgttctcctctgtc
cgtagccgaaaccggcacagtcagaatcccaacctgcataaaaacattcccttcacttca
gtagattag

DBGET integrated database retrieval system