KEGG   Gallus gallus (chicken): 432368
Entry
432368            CDS       T01006                                 

Gene name
SNAI2
Definition
(RefSeq) LOW QUALITY PROTEIN: zinc finger protein SNAI2
  KO
K05706  snail 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    432368 (SNAI2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    432368 (SNAI2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 Snail
    432368 (SNAI2)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_jaz zf-C2H2_6 zf-met zf-Di19 zf-C2HE zf-BED Elf1 zinc_ribbon_15 Ogr_Delta zf-H2C2_5 Zn-ribbon_8 zinc_ribbon_9
Other DBs
NCBI-GeneID: 432368
NCBI-ProteinID: XP_419196
CGNC: 54314
Ensembl: ENSGALG00000030902
Position
2
AA seq 268 aa
MPRSFLVKKHFNSSKKPNYSELDTHTVIISPYLYESYXVPIIPQPEILSSVAYNPITVWT
TTGLLPSPLPNDLSPLSGYPSSLGRVSPPPPSDTSSKDHSGSESPISDEEERIQSKLSDP
HAIEAEKFQCGLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRT
HTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKK
YQCKNCSKTFSRMSLLHKHEESGCCVAH
NT seq 807 nt   +upstreamnt  +downstreamnt
atgccacgctccttcctggtcaagaaacatttcaattcatccaagaagccaaactacagc
gaactggacactcatacagtgattatatccccatacctgtatgaaagctacnccgtccct
atcataccgcagccagagatcctgagctctgtagcttacaaccccattactgtgtggact
acaaccgggctgctaccgtctcctctacccaatgacctctctccgctttctggatacccc
tcatctttgggaagggtcagcccacctccaccatccgacacctcctccaaagatcacagc
ggttcagaaagtcccattagcgatgaagaagagagaatccagtccaagctttcagaccct
catgccatcgaagccgaaaagtttcagtgcggtttatgcaacaagacctattccactttc
tctgggttggccaaacacaagcagctgcactgtgatgcccagtctaggaaatcgttcagc
tgcaagtactgtgacaaggagtatgtcagcctgggagcacttaagatgcacatcaggacc
cacacgctaccttgcgtctgcaagatctgcggcaaggctttctccagaccctggctactt
caagggcacatcagaacccacactggagagaaaccgttttcctgtcctcactgcaacagg
gctttcgcagacagatccaatctgagggctcatctgcagacccactcggatgtgaagaaa
taccagtgcaaaaattgctccaaaactttctccagaatgtctcttctgcacaaacatgag
gaatctggctgctgcgtagcacactga

DBGET integrated database retrieval system