KEGG   Gallus gallus (chicken): 493647Help
Entry
493647            CDS       T01006                                 

Gene name
BMI1
Definition
(RefSeq) polycomb complex protein BMI-1
  KO
K11459  polycomb group RING finger protein 4
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    493647 (BMI1)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     493647 (BMI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-rbx1 Prok-RING_4 zf-RING_UBOX zf-C3HC4_4 zf-RING_10 zf-Nse PcfK
Motif
Other DBs
NCBI-GeneID: 493647
NCBI-ProteinID: NP_001007989
CGNC: 54322
Ensembl: ENSGALG00000041267
UniProt: Q5SDR3
Position
2
AA seq 326 aa AA seqDB search
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQV
HKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADE
DKRIITDDEIISLSIEFFDQNRLERKGNKEKEKSKEEVNDKRYLRCPAAMTVMHLRKFLR
SKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKIGHQR
EGLSNSGELESDSGSDKASSPAGGLPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSSSP
GSNHQSSFTNRARKSSINGSSATSSG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcaccggacgaccaggatcaaaatcaccgagctgaacccgcacctcatgtgcgtgctg
tgcggcgggtacttcatcgacgcgacgaccatcatcgagtgcctgcactccttctgcaag
acgtgcatcgtgcggtacttggagacgagcaagtactgcccgatctgcgacgtccaagtg
cacaaaacccggccgctgctcaacatcaggtcagataaaactctccaggatatcgtgtac
aagctcgtaccgggccttttcaaaaatgaaatgaaaagaagaagggatttctatgctgct
catccgtcggctgatgctgccaatggctctaatgaagacaggggagaagtggctgacgaa
gacaaaagaattataacagacgacgagataataagcttatccattgagttctttgaccag
aacagactggaacgaaaaggaaataaagagaaagaaaagtcgaaggaggaggtgaacgac
aaaagatatttgcgctgcccggcagcgatgacagtgatgcatctacgaaagttcctgcgg
agtaagatggatatccccaacactttccagatcgacgtgatgtacgaggaggagcccctg
aaggactactacacgctgatggacattgcctacatctacacctggagacggaacggcccg
ctgcccctcaagtaccgcgtgcggcccacctgcaagaggatgaagatcggccaccagcgg
gaaggcctcagcaacagcggcgagctggagagcgactccggcagcgacaaggccagcagc
ccggccggggggctgccctccacctcctcctgcctgcccagccccagcacgccggtccag
tccccccacccgcagttcccacacatctccagcaccatgaacggcaccagcagcagcccc
ggcagcaaccaccagtcctccttcaccaacagagcacggaaatcctccataaacggctcc
tcagccacttcgtccggctga

DBGET integrated database retrieval system