KEGG   Gallus gallus (chicken): 497224
Entry
497224            CDS       T01006                                 

Symbol
PCDHAC2
Name
(RefSeq) protocadherin alpha-C2 precursor
  KO
K16493  protocadherin alpha
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    497224 (PCDHAC2)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:gga04515]
    497224 (PCDHAC2)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    497224 (PCDHAC2)
Cell adhesion molecules [BR:gga04515]
 Cadherins
  Protocadherins
   497224 (PCDHAC2)
SSDB
Motif
Pfam: Cadherin Cadherin_tail Cadherin_2 Cadherin_C_2 Big_9 Cadherin_4
Other DBs
NCBI-GeneID: 497224
NCBI-ProteinID: NP_001104601
CGNC: 54336
UniProt: Q6R0H8
Position
13:complement(1336006..1378954)
AA seq 992 aa
MAAAARRSRGGAVALGLPLLLVLGLSSGRTAGGPLRYSVREELPHGAFVGNVASDLGVDP
RRLAERGARLTSGSGRQYLELELGRGALLVRERMDREVLCELSPTCFLSLELVIEQPIEV
HNVEVEVLDINDNAPRFPRQDYRLEISESAVPGARFHIESAQDPDVGTNSVQSYQLSPSH
HFALDLKGFQSGSKLLELVLQQPLDREQSALLQLVLTAVDGGDPPRSGTAQISVRVVDTN
DNPPAFDRSTYTVNLLENSPPGTLVVKLNASDPDEGSNGDVIYSFGSYTPQKVRQLFRVD
PHSGEVRVNGTLDYEEASSYEIYVQATDQGPVSMAGHCKVLVNIVDANDNVPEVVLTSLY
SPVPEDAKPGTVVALMSVTDQDSGLNKQVSLRIPPGLPFMLNSFKNSYTLMTQGNLDREK
AAAYNITVTATDSGSPPLYSQKVIHVVISDINDNPPLFEEPVYSVYIPENNPLGVLLCTI
KATDPDVAENAYISYSLLDGEIEGLPAASFVTIKSDSGDMYAVKSFDYETLREFHVVVQA
QDAGIPSLSSTVTVYIYVVDVNDHAPEILYPTSTNTSAALEMIPRSAHAGYLVTKIIAID
GDSGQNAWLFYYVVQTSDPDLFRIELHTGEIRTTRKLREEGTPTFNLTVEVRDNGEPPMS
SSVAITVAVVDRVSKIIPDTRRHIRSPSNYSEITLYLIIALCSISFVFLFTIIGLTVIKC
YRYSLYGDSCCTGFCGVRERCPAELYKQANNNIDARLPHGLKVQPHFIEVRGNGSLTKTY
CYKACLTAGSGSDTFMFYNTCGPTGTVPSAVVTERHLTGQSGQSAQNLIILKNDSITPNE
PKHPNPDWRYSASLRAGMQRVLCIWRRQGSYVEDQEGLTSSGQQSPVLLQPEAGEVSPPV
GAGVNSNSWTFKFGPSNSKQGGPGELPDKFIIPGSPAIISIRQEPPNSQIDKSDFITFGK
KEETKKKKKKKKGNKTQEKKEKGNSTTENSDQ
NT seq 2979 nt   +upstreamnt  +downstreamnt
atggcggcggcggctcggcggagccgcggcggggcggtggcgctgggcctgccgctgctg
ctagtgctggggctgagcagcgggcggacggcgggcgggccgctccgctactcggtgcgg
gaggagctgccgcacggcgccttcgtgggtaacgtggcgagcgacctgggcgtggatccg
cggcgactggcagagcggggagcgcggctcacgtcgggcagtggccggcagtacctggag
ctggaactgggccgtggggcactgctggtacgggagcgtatggaccgagaggtgctctgt
gagctgagccccacctgcttcctcagcctcgagctggtcatcgagcagcccatcgaggtg
cacaacgtggaggtggaagtgctggacatcaatgacaacgcacctcgctttccccgccag
gattaccggttggagatcagtgagtctgccgttcccggggcccgcttccacattgagagt
gctcaggaccctgatgtgggcaccaactctgtgcagagctaccagctgagccccagccac
cactttgccctggaccttaaaggcttccagagtggcagcaagctcctggagcttgtgctg
cagcagccactggaccgggagcagagtgccctgctgcagctagtgctcactgccgtggac
ggtggggatcctcccaggtccggcacagctcagatctctgtgcgagttgtggataccaat
gacaacccacctgcctttgaccgctccacatacaccgtgaacctgctggagaactccccc
cctggcacgctagttgtcaaactcaatgcttcagaccccgatgagggctccaatggggat
gtgatctattcttttggcagctataccccacagaaggtgaggcagctctttcgtgtggat
ccacattcaggggaggtacgggttaatggcaccttggattatgaagaagcatcctcttat
gagatctatgtgcaagccactgatcaaggccctgtctctatggctgggcactgcaaagta
ctggtcaacattgtggatgccaatgataatgttcctgaggtggtcctgacctccctgtac
agcccagtgccagaggatgcaaagccaggaactgtggtggctttgatgagtgtcacagac
caggactcaggactgaacaagcaggtgagcctgcgtattccccctggcctcccctttatg
ctcaactctttcaagaattcctacaccttgatgacccaaggcaatctggaccgtgagaaa
gcagcagcctacaacatcacagttacagctactgactctgggagcccccctctctactcc
cagaaggtgatccatgtggtcatctctgacatcaatgacaatcctccactcttcgaggaa
cctgtgtactcagtttacatccctgagaacaacccccttggagttttgctttgcactatc
aaagccactgacccggatgttgccgaaaatgcctacatatcctattctctgttggatggg
gagattgaagggctacctgccgcctcctttgttaccattaaatccgacagcggtgacatg
tatgctgtcaaatcctttgactatgagacactaagggagtttcatgttgttgtccaggct
caggatgctgggatcccatcactgagcagcactgtcactgtctacatctatgtggtagac
gtgaatgaccatgctccagagattctgtatcctacctcaaccaacacttcagcagccctg
gagatgatcccacgctcagctcatgctggatatttggtaaccaagattatagccattgat
ggggactcaggacaaaatgcctggttgttctactacgtggtgcaaacctcagatccggat
ttgttcaggatagagctccatactggggagattaggactactcggaaactgagggaggag
ggcacacctactttcaacctgacggtggaggtgagagacaatggagagccaccgatgtcc
tcgtcagtagccatcactgttgctgtggtggacagagtttccaaaatcatccctgataca
agaaggcacattagaagtccgagcaattattcagaaatcactctttatctcatcattgct
ttgtgctccatctcctttgttttccttttcacaatcattgggcttactgttatcaagtgc
tacagatacagtctgtacggggactcctgctgtacaggtttttgtggggtcagagaacgg
tgccctgctgaattgtacaagcaggccaacaataacatcgatgcaaggttgcctcatggt
ttaaaagtgcagccccatttcattgaagtgcggggcaatgggtctctcactaagacctac
tgctataaggcttgcttaactgcaggatcgggaagtgacacttttatgttttacaatact
tgtgggccaacaggaacggttccctctgcagtggtgactgagaggcatctgacaggacag
agtgggcagagtgcacaaaacctgatcatacttaaaaatgactccattactcctaatgag
ccaaaacaccccaatcctgactggcgctactccgcgtccctaagggcgggaatgcaaagg
gtgctgtgcatatggaggaggcagggatcttacgtggaggaccaggagggcctgaccagc
agtggccaacagtctccagtgctactccagcctgaggcaggagaggtgtcccccccggtg
ggagctggtgtgaacagcaacagctggacctttaaatttggacccagcaattcgaaacaa
ggtggtcctggtgagttgccagacaaattcattatcccaggatctcctgcaatcatctcc
atccggcaggagccaccaaacagccaaattgacaaaagtgacttcataacctttggcaag
aaggaagagaccaagaaaaagaagaaaaagaagaagggaaacaagactcaggagaaaaaa
gaaaagggcaacagcaccactgagaacagtgaccagtga

DBGET integrated database retrieval system