KEGG   Gallus gallus (chicken): 503512
Entry
503512            CDS       T01006                                 

Gene name
FOXL2
Definition
(RefSeq) forkhead box protein L2
  KO
K09405  forkhead box protein L
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    503512 (FOXL2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    503512 (FOXL2)
SSDB
Motif
Pfam: Forkhead
Other DBs
NCBI-GeneID: 503512
NCBI-ProteinID: NP_001012630
CGNC: 54339
Ensembl: ENSGALG00000029282
UniProt: Q5J7N5
Position
9
AA seq 305 aa
MMSGYADGEEDAVAMLAHDGGGSKEPERGKEELSAEKGPEKPDPSQKPPYSYVALIAMAI
RESAEKRLTLSGIYQYIISKFPFYEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNY
WTLDPACEDMFEKGNYRRRRRMKRPFRPPPTHFQPGKSLFGPDGYGYLSPPKYLQSTFMN
NSWPLPQPPAPVPYASCQMSGGSVSPVNVKGLSGPASYGPYSRVQSVALPGMVNSYNGVA
HPHHPHAHHPQQLGPASPAPPAAPAANGAGLQFACARQPAELSVMHCSYWEHDSKHGALH
SRIDI
NT seq 918 nt   +upstreamnt  +downstreamnt
atgatgagcggctacgcggacggcgaggaggacgcggtggcgatgctggcccatgacggc
ggcggcagcaaggagccggagcggggcaaggaggaactgagcgccgagaagggccccgag
aagccggacccgtcgcagaagcccccctactcctacgtggccctgatcgccatggccata
cgggagagcgccgagaagaggctcacgctgtccgggatctaccagtacatcatcagcaag
ttccctttctacgagaagaacaagaagggctggcagaacagcatccgccacaacctcagc
ctcaacgagtgcttcatcaaggtgccccgcgagggcggcggcgagcgcaagggcaactac
tggacgctggaccccgcctgcgaggacatgttcgagaagggcaactaccgccggcggcgg
aggatgaagcggcctttccggccgcccccgactcacttccagcccggcaagagcctcttc
ggccccgacggctacggctacctctccccgcccaagtacctgcagtccaccttcatgaac
aactcgtggccgctgccgcagccccccgcgcccgtgccctacgcctcttgccagatgtcc
ggcggcagcgtcagccccgtcaacgtgaaaggactctcgggccctgcctcctacggcccc
tactcgcgggtgcagagcgtggcgctgcctggcatggtgaactcctacaacggcgtggcc
cacccgcaccacccgcacgcccaccacccgcagcagctgggcccggccagccccgcgccg
cccgccgccccggctgcgaacggagccggcctccagttcgcctgcgcccgccagcccgcc
gagctgtccgtcatgcactgttcctactgggagcacgacagcaaacacggcgccctgcac
tcccgcattgacatctag

DBGET integrated database retrieval system