KEGG   Gallus gallus (chicken): 503574
Entry
503574            CDS       T01006                                 

Gene name
SNRNP200
Definition
(RefSeq) U5 small nuclear ribonucleoprotein 200 kDa helicase
  KO
K12854  pre-mRNA-splicing helicase BRR2 [EC:3.6.4.13]
Organism
gga  Gallus gallus (chicken)
Pathway
gga03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    503574 (SNRNP200)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gga03041]
    503574 (SNRNP200)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     503574 (SNRNP200)
Spliceosome [BR:gga03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    503574 (SNRNP200)
 Complex C
   U5 SnRNP specific factors
    503574 (SNRNP200)
SSDB
Motif
Pfam: Helicase_PWI DEAD ResIII IstB_IS21
Other DBs
NCBI-GeneID: 503574
NCBI-ProteinID: NP_001012719
CGNC: 15482
Ensembl: ENSGALG00000031298
UniProt: Q5F463
Position
22
AA seq 614 aa
MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTK
PQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFI
QAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHVLVNLGKKIT
DYGGDKEIQNMDDNIDETYGVNVQFDSDEEEGDEDIYGEVRDEASDDDMEGDEAVVRCTL
SANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDR
ECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFL
YQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGGEALAPRQVLDLEDLVFAQGS
HFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLVSVEKLPKYAQAGFEGFKT
LNRIQSKLYRAALESDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTITWTSSDYLH
CTHEVFGAGDGGQLREAPGNLWHQRGRADRGSPAVQGGNQCHPDHRLHPGEVGHHHSQGG
RAHVHPAGAAGHPG
NT seq 1845 nt   +upstreamnt  +downstreamnt
atggcggacgtgaccgctcgcagcctgcagtacgagtacaaggcgaactccaacctcgtg
ctccaagctgaccgctctctcattgaccggacgcggcgcgatgaaccaacgggggaggtg
ctgtccctggtgggcaaactggagggcacccgtatgggcgacaaggcgcagcgcaccaag
ccgcagatgcaggaggagcgacgcgccaagagaaggaagcgtgatgaggacaggcacgac
atcaacaagatgaagggctacacgctgctgtccgagggcatcgacgagatggtggggatc
atctacaagcccaaaaccaaagagacccgcgagacctacgaggtgttgctgagcttcatc
caggctgcccttggggaccagccacgagacattctgtgcggagctgctgatgaggtgctg
gcagtgctgaagaacgagaagctgcgagataaggagaggcgtaaggagatcgatctgctg
ctgggccagaccgacgacacccgttaccacgtgctggtgaacctgggcaagaagatcacg
gactacggtggtgacaaggaaattcagaacatggatgacaacatcgatgagacgtacggc
gtgaacgtgcagtttgactctgacgaggaggaaggtgatgaggacatctatggcgaggtg
cgtgacgaggcgtccgatgatgacatggaaggagacgaagccgtcgtccgctgcaccctc
tcagccaatcttgtggcatcaggtgaattgatgagctcaaagaagaaggatctccatccc
cgagacatcgacgccttttggctccagcgacagctgagccgcttctatgacgatgccatc
gtttcccagaagaaggcagatgaagtgctggagatcctgaagactgcgagcgatgaccgg
gagtgtgagaaccagcttgttctgctcctgggcttcaacaccttcgacttcatcaaagtg
ctgcggcagcaccggatgatgatcctgtactgcactttgctggccagcgcccaaagcgaa
gccgagaaagaaaggataatggggaagatggaagcagatcctgagctgtccaagttcttg
taccaactgcacgagacggagaaggaggatctcatccgggaggagcgctctcgccgggag
cgcgttcggcagtcccggatggacactgacttggagaccatggatctcgaccagggagga
gaggcgttggctccccggcaggtgctggacttggaagacctggtgtttgctcagggcagt
catttcatggccaacaagcgatgccagctgcccgacggctccttccgtaggcagcgcaag
ggctacgaggaggtgcacgtgcctgccctgaaaccaaagccttttggctctgaggagcaa
ttggtttctgtggaaaagctgcccaaatatgcccaggctggattcgaagggtttaaaaca
ctgaaccgtatccaaagcaaactctaccgcgctgcgttggagtcagatgagaacctgctg
ctgtgtgctcccacgggcgctgggaagacgaacgtggcgctgatgtgcatgctgcgagaa
atagggaagcacatcaacatggacgggaccatcacgtggacgagttcagattatctacat
tgcacccatgaggtctttggtgcaggagatggtgggcagcttcgggaagcgcctggcaac
ctatggcatcaacgtggcagagctgacaggggatcaccagctgtgcaaggaggaaatcag
tgccacccagatcatcgcctgcaccccggagaagtgggacatcatcactcgcaagggggg
agagcgcacgtacacccagctggtgcggctggtcatcctggatga

DBGET integrated database retrieval system