KEGG   Gallus gallus (chicken): 554220
Entry
554220            CDS       T01006                                 

Gene name
OTP
Definition
(RefSeq) homeobox protein orthopedia
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Homeodomain OAR Homeobox_KN
Other DBs
NCBI-GeneID: 554220
NCBI-ProteinID: XP_003643004
CGNC: 54343
Ensembl: ENSGALG00000026744
UniProt: R4GH47
Position
Z
AA seq 325 aa
MLSHADLLDARLGMKDAAELLGHREAVKCRLGVGGSDPGGHPGDMAPNSDTVEGTTLLPG
EDITTVGSNPSSLAVSAKDADKQQGQQGGQNPSQAGQQQGQQKQKRHRTRFTPAQLNELE
RSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTLLPTPG
LPQFPSAAAAAAAAMGDSLCSFHANDTRWAAAAMPGVSQLPLPPALGRQQAMAQSLSQCS
LAAGPPPNSMGLSNSLAGSNGAGLQSHLYQPAFPGMVPASLPGPSNVTGSPQLCSSPDSS
DVWRGTSIASLRRKALEHTVSMSFT
NT seq 978 nt   +upstreamnt  +downstreamnt
atgctgtctcacgccgacctcctggacgcccgtctcgggatgaaagatgcggccgagctg
ctgggacaccgggaggcggtgaagtgccggctgggcgtggggggctcggatccggggggt
cacccgggagacatggccccgaactcggacacggtggaagggaccaccctgctgccgggg
gaggacatcaccacggtgggatccaatcccagctccttggccgtcagcgccaaagacgcc
gacaagcagcaaggccagcagggcggccagaaccccagccaggcgggacagcagcagggc
cagcagaagcagaagcggcaccgcacccgcttcacgccggcgcagctcaacgagctggag
aggagcttcgccaagacccactacccggacatcttcatgcgggaggagctggccttgcgc
atcggcctcaccgagtcccgggtgcaggtgtggttccagaaccgccgggccaagtggaag
aagcgcaagaagacgaccaacgtcttccgagccccgggcacgctgctgccgacgccgggg
ctgccgcagttcccctcggccgccgccgccgccgccgccgccatgggcgacagcctctgc
tccttccacgccaacgacacgcgctgggccgccgccgccatgcccggggtgtcgcagctg
ccgctgccgccggcgctgggcaggcagcaggccatggcgcagtccctgtcccagtgcagc
ctggcggccgggccgccgcccaactccatggggctctccaacagccttgcgggctccaac
ggcgccgggctgcagtcgcacctctaccagcccgccttccccggcatggtgcccgcctcg
ctgcccggccccagcaacgtgacgggctcgccgcagctctgcagctccccggacagcagc
gacgtgtggcggggaaccagcatcgcctccctccgccgcaaagcactagagcacacagtc
tccatgagcttcacctaa

DBGET integrated database retrieval system