KEGG   Gallus gallus (chicken): 693249Help
Entry
693249            CDS       T01006                                 

Gene name
CAPN1
Definition
(RefSeq) calpain-1 catalytic subunit
  KO
K01367  calpain-1 [EC:3.4.22.52]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04141  Protein processing in endoplasmic reticulum
gga04210  Apoptosis
gga04217  Necroptosis
gga04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    693249 (CAPN1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    693249 (CAPN1)
   04217 Necroptosis
    693249 (CAPN1)
   04218 Cellular senescence
    693249 (CAPN1)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     693249 (CAPN1)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C2: calpain family
   693249 (CAPN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_8 EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 693249
NCBI-ProteinID: NP_001038137
CGNC: 49714
Ensembl: ENSGALG00000041685
UniProt: O42133
AA seq 715 aa AA seqDB search
MAEEPVVPVFCTGVSAQVQRQRAKALGLGQHQNAVRFRGQDYAALRDDCLRSGSLFRDET
FPPSASSLGFRELGPGSSKTRGVTWKRPTELCRHPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNETILHRVVPHGQSFQNGYAGIFHFQIWQFGEWQDVVVDDYLPTKDGKLLFVHS
AEGTEFWSALLEKAYAKVNGCYEALSGGSTSEGFEDFTGGVTEWYDLRKPPADLYQIILK
ALERGSLLGCSIDITSAFDMEAVTFKKLVKGHAYSVTGAKQISYRGQSLGLIRMRNPWGE
VEWTGAWSDNSSEWNAVEPALRQQLMVRMEDGEFWMSFRDFLREFTRLEICNLTPDALQS
RKFRKWNTRLYDGSWRRGSTAGGCRNYPATFWINPQFKICLEEVDDDGDDFGGREPGCSF
LLALMQKHRRRERRYGKDMETIGFAVYEVPPEHVGHSGVHLQRDFFLSNASRARSEQFIN
LREVSTRLRLPPGEYIVVPSTFEPNREGDFVLRVFSEKRADTEEIDDKIEAKLPDEKVLS
EGEIDENFKQLFRQLAGPDMEISVTELQTILNRIIAKHKDLRTKGFSLESCRSMVNLMDK
DGNGKLGLVEFNVLWNRIRNYLSVFRKFDLDKSGSMSAYEMRMALEASGYKLTQKLHQLL
ITRYAEPDLAIDFDSFVCCLVRLETMFRFFQAMDGDNDGVVTFGLLQWLQLTMFA
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggagcccgtggtgcccgtgttctgcaccggggtgtcggcgcaggtgcagcgg
cagcgggcgaaggcgttgggtttggggcagcaccagaacgccgtgcggttccgcggccag
gactacgcggcgctgcgcgacgactgcctgcgctcggggagcctcttcagggacgaaacc
tttcccccttctgcttcatctctgggcttccgggagctcgggcccggctcttccaaaacc
cgcggcgtgacgtggaagaggccgacggagctgtgtcggcaccctcagttcatcgtagac
ggggcgacgcgcaccgacatctgccagggagctctgggtgactgctggttgctggcagcc
atcgcgtccctaacgctgaatgagaccatcctgcaccgcgtggtgccacatgggcagagc
ttccagaacggctacgccgggatcttccacttccagatctggcagtttggtgagtggcag
gacgtggtggtggacgattacctgcccaccaaggatggcaaactgctcttcgtccactcc
gccgagggcaccgaattctggagtgctttgctggagaaagcctacgccaaggtgaacggg
tgctatgaagcgctgtcgggcggcagcacctcggagggcttcgaggatttcaccgggggg
gtcacagagtggtacgacctgcgcaagccccccgcagacctctaccagatcatcctgaag
gcgttggagaggggatccctcctggggtgctccatcgatataacgagtgccttcgacatg
gaggcggtgacattcaagaagctggtgaagggccatgcctactcggtgacgggagccaag
cagatcagctaccgcgggcagtcgctgggtctgatccgcatgcgcaacccgtggggcgag
gtggagtggaccggagcctggagcgataactcctccgaatggaacgcggtggagccggcg
ctgaggcagcagctgatggtgagaatggaggacggggagttctggatgtctttccgggac
ttcctgcgggaattcacccgcctggagatctgcaacctcacccccgacgccctccagtcc
cggaagttccgcaagtggaacacgcggctctacgacggctcgtggcggcgcggcagcacg
gccggcggctgcaggaactaccccgccacgttttggatcaaccctcaattcaagatctgc
ctggaggaggtggacgacgacggggacgattttggtggccgtgagccgggctgcagcttc
ctgctggccctcatgcagaagcaccgacgccgcgagcgccgctacgggaaggacatggag
accatcggctttgctgtctacgaggttccccccgagcacgtggggcactcgggggtccac
ctgcagcgcgacttcttcctgtccaacgcgtcccgcgcgcgctccgagcagttcatcaac
ctgcgggaggtcagcacgcgcctgcggctgccgcccggggagtacatcgtggtgccctcc
accttcgagcccaaccgcgagggggacttcgtgctgcgggtcttctccgagaagagagcc
gacaccgaagaaatcgatgacaaaatagaggcgaagctcccggatgagaaagtgctgtcc
gagggcgaaatcgatgagaacttcaagcagctcttccggcagttggcggggccggacatg
gagatcagcgtcacggagctgcagacgatcctcaaccgcatcatcgccaaacataaagac
ctgcgcaccaaagggttcagcctggagtcgtgtcgcagtatggtcaacctgatggacaaa
gatgggaacgggaagttgggcctggtggagttcaacgtcctatggaataggatccgcaat
tacctgtcagtgttccgcaaattcgacctggacaagtctggcagtatgagcgcctatgag
atgcggatggcactggaggcatcgggctacaaactgacccaaaagctgcaccagctcctc
atcacgcgctacgccgagcccgacctcgccatcgacttcgactccttcgtctgctgcctc
gtccgcctggagaccatgttccgcttcttccaggcgatggatggggacaatgacggcgtc
gtcacctttggcttgctgcagtggctgcagctcaccatgtttgcctaa

DBGET integrated database retrieval system