KEGG   Gallus gallus (chicken): 693263
Entry
693263            CDS       T01006                                 

Symbol
PGLYRP2
Name
(RefSeq) N-acetylmuramoyl-L-alanine amidase precursor
  KO
K01446  peptidoglycan recognition protein
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Amidase_2
Other DBs
NCBI-GeneID: 693263
NCBI-ProteinID: NP_001038151
CGNC: 54358
Ensembl: ENSGALG00000029971
UniProt: A0A1L1RRT4
Position
30:764595..770065
AA seq 463 aa
MCCSAAAVLLLLAVLSARTQAALLPHHISSLIPILQSLEADGTPDIPSLVRSLGGCGTPV
CHTLLGDPPPTPTPIPEPWALLAHLLHPNATAAERGALLAPDGSTVALAPLFAGVEVGLK
RAAGRPGPIDQPYASLDALYAVTITEALGTSFLVARVNGTAALGPDGCWDDVDNPQNFTL
LGPPSLVPHAVANGAMDGVLLGTRLAEDPIPLSVLFRRYYGVDNGIARGWPHSSRRRRDF
GALTAVGKLEEEVAAMLRVLRGLPHTHELLEEFGEEEEADIARRAAREFMEVYVECPAII
PRCMWGARPYRGTPRPLSPPLGSIYIHHTFVPSAPCRSFTACARDMRSMQRFHQDTRGWD
DIGYSFVVGSDGYLYQGRGWRWVGAHTRGHNTKGYGVGYVGNFSASLPDPEAIALVRDGL
IPCAVRAGWLHQNYTLHGHRQMVNTSCPGDALFQEIQTWHGFK
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgtgctgctccgctgctgctgtcctcctgctgctggcggtgctcagcgcccgcacccaa
gcagccctcctcccacaccacatctcctctctgatcccaatcctacaatccctggaggct
gatggcaccccggacatcccatctctggtgcggtcactggggggctgcgggacccccgtg
tgtcacaccctgctcggggacccccctcccaccccaacgcccatccctgagccgtgggcg
ctgctcgcccacctcctccaccccaacgccacggcagcagagcgcggcgcgctgttggca
cccgatggttccaccgttgcgttggcaccgctcttcgccggcgtcgaagtggggctgaag
agggcagcggggcggcccggccccattgatcagccctacgcctctctcgacgcgctctac
gccgtcaccatcaccgaagctctggggacatccttcctcgtggcacgggtcaacgggacg
gccgcgttgggacccgatgggtgttgggatgatgtggacaacccccaaaacttcaccctg
ttgggtcccccgtcactcgtcccccacgctgtcgccaacggggcgatggatggggtgctg
ttgggcacccgcttggctgaagaccccatcccactctccgtcctattccggagatattat
ggtgtggataatgggatcgcaagagggtggccccacagcagccgccggcgtcgggatttc
ggggcgctgacggcagtggggaagttggaggaggaggtggcggcgatgctgagggtactg
agggggctgccccacacccatgagctcctggaggaatttggggaggaggaggaggcggac
atcgctcgtcgggcggcacgggagttcatggaggtgtatgttgagtgcccagccatcatt
ccccgctgcatgtggggtgcccgtccctaccggggcacccccagacccttgtccccacct
ttgggttccatctacatccaccacaccttcgtgcccagcgccccatgccgctccttcacc
gcctgcgcccgcgacatgcgctccatgcagcgcttccaccaggacacccgtggctgggat
gacatcggctacagcttcgtggtgggttcggatggatacctgtaccaagggagaggttgg
cgctgggtgggtgcccacaccagaggtcacaacaccaagggctacggagtgggctacgtg
ggcaacttctcagccagcttgccagatcccgaggccattgctttggtgcgcgatggtctc
ataccatgtgccgtgagggctgggtggctccaccagaactacactctgcatggccacagg
caaatggtgaacaccagctgcccgggggacgcccttttccaggagatccaaacctggcac
ggctttaagtga

DBGET integrated database retrieval system