KEGG   Gallus gallus (chicken): 768427Help
Entry
768427            CDS       T01006                                 

Gene name
PPIC
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase C
  KO
K09563  peptidyl-prolyl isomerase C (cyclophilin C) [EC:5.2.1.8]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:gga03110]
    768427 (PPIC)
Enzymes [BR:gga01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     768427 (PPIC)
Chaperones and folding catalysts [BR:gga03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    768427 (PPIC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 768427
NCBI-ProteinID: XP_001231333
CGNC: 3979
UniProt: F1NZW7
Position
Z
AA seq 359 aa AA seqDB search
MSKRRPAPGCKAAPSGQCGPAASTGLYPGATQPQAPSLDVLSQAAVILPPAAQQLQSNYS
SLGRWNSAARRSHRGAACAFVTGSAAPSPRGETPPATRQPRPKRAGRRPPAAPPPKRSGA
AAEGWPPPRHMAREEPPGRPAAGAGAAAFGRAMARGRTALGAIAWLCLLAAAAEGLRRRG
PSVTAKVFFDVKIGDRDVGRITIGLFGKVVPKTVENFIVLATGERGYGYKGSKFHRVIKD
FMIQGGDFTAGDGSGGRSIYGERFPDENFKLKHYGIGWVSMANSGPDSNGSQFFISVTKP
SWLDGKHVVFGKVLDGMSVVHLIELQQTDEHDRPLHDCVIVNSGKIAVREPFVVEVDDW
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacgcagaccggccccgggctgcaaggctgcaccgtcggggcagtgcggccct
gcggccagcactgggctctacccgggcgctacgcagccgcaagctccgtccctggacgtg
ctctcacaagccgctgtcatcctcccgcctgcagcacagcagctacagagcaactattct
tccctcgggcgctggaactcggcagcccgcaggtctcaccgcggagcagcctgcgcgttt
gtcactggcagcgcagcgccatctccccgcggggaaaccccccccgccacaaggcagccc
cgtccgaagcgggccggccgccgcccccccgccgctcctcccccgaagcgaagcggggca
gcggcggagggatggccgcccccccgccacatggcgcgggaggagccgcccggccggccg
gcggcgggcgcaggcgccgcagcgttcggtcgcgccatggcccgtgggcggactgcgctc
ggcgccatcgcatggctctgcctgctggccgcggcggccgaggggctgaggaggagggga
cccagcgtgacggccaaggtgttctttgacgtgaagattggagacagagacgttggcaga
atcacgattgggttgttcggaaaggttgtcccgaaaacggtggagaacttcattgtgctg
gcaactggagaaagaggatacggatacaaaggaagtaaattccatcgtgtgatcaaagac
ttcatgatccaaggaggggactttacagctggagatggatcaggaggaagaagcatttat
ggagaaaggtttccagacgagaacttcaagctcaaacactatggaattggatgggttagc
atggctaattctggcccagacagcaacggatcccagttctttatcagcgtgacaaagcct
tcctggttagatgggaaacacgtagtgtttggcaaagtccttgatggaatgtctgtggtg
cacttgatagagcttcagcagacggatgaacacgaccgccctcttcatgactgcgtgatt
gtgaacagcggcaaaatagctgtaagggaaccattcgtagtggaagtagatgactggtga

DBGET integrated database retrieval system