KEGG   Gallus gallus (chicken): 768530Help
Entry
768530            CDS       T01006                                 

Gene name
PLA2G15
Definition
(RefSeq) group XV phospholipase A2
  KO
K06129  lysophospholipase III [EC:3.1.1.5]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00564  Glycerophospholipid metabolism
gga04142  Lysosome
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    768530 (PLA2G15)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    768530 (PLA2G15)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     768530 (PLA2G15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LCAT DUF915 Abhydrolase_6 PGAP1 Hydrolase_4 DUF900
Motif
Other DBs
NCBI-GeneID: 768530
NCBI-ProteinID: XP_001231519
CGNC: 492
Position
11
AA seq 415 aa AA seqDB search
MVPPAGARLLPRPGRSPLLSILLLLLCSGGGCLPRRRPAGPPVVLVPGDLGNQLEAKLDK
PSVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSKVTEPPDGVDIRVPG
FGQTFSLEFLDPSKRSVGSYFYMLVQSLVDWGYKRDEDVRGAPYDWRKAPNENGDYFVAL
RKMIELMYEQYGSPVVLIAHSMGNMYTLYFLNHQTQEWKDKYIKDYVSLGAPWGGVAKTL
RVLASGDNNRIPVISSLKIRDQQRSAVSTNWMLPYNYTWPPDKVFVSTPTANYTLRDYRK
FYRDIDFEDGWLMRQDTEPLVYQMVPPGVRIHCLYGTGVETPDSFHYESFPDKEPKIIYS
DGDGTVNLQSALQCQKWVDMQKQEVMIFELSGNEHIQMLSNDTTISYVKKLLFNL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggtgccgccggccggcgctaggctcctcccgcgcccgggaaggagccccctcctcagc
atccttctcttgctgctctgctccggcggtgggtgtctgccgcgccgccggcccgcgggg
ccgcccgtggtgctggttccaggggacttaggtaatcagttggaagcaaaattagataag
ccatcagtagtgcactatctctgctctaagaagactgacagttactttacactgtggctg
aacttagaattgctcctgcctgtcatcattgactgctggattgacaatatcaggctggta
tataacagaacaagcaaagtaacagaaccaccagatggagtggatatcagagtcccaggt
tttgggcagacattttcattggaattccttgatccgagtaaaaggagcgttggcagttac
ttctatatgctggtgcagagtttagtagactggggctacaaacgtgatgaagatgtaaga
ggagcaccttatgactggcgaaaggcaccaaatgagaatggagattattttgtggccctt
cgcaagatgatagagttaatgtatgagcagtatggaagtcctgttgtcttaattgcccac
agcatgggtaatatgtacaccctgtacttcctcaatcatcagactcaggaatggaaagat
aaatacataaaagactatgtgtcattaggtgctccatggggaggagtggccaaaactctc
cgtgtgctggcttcaggtgacaacaatagaataccagtcatcagttcactcaagattcga
gaccagcagagatcagctgtttccacaaactggatgctcccctacaactacacatggcct
ccggacaaggtctttgtaagcacaccaactgctaactacaccctacgagactacagaaaa
ttctacagggacattgactttgaagatggctggctcatgagacaagacactgaacccttg
gtctaccagatggtaccacctggtgtacgcatacactgtctttatggtactggtgtggaa
acacctgattccttccattacgaaagctttcctgacaaagagcccaagattatttacagt
gatggggatggtacagtgaacttacagagtgccttgcaatgtcagaaatgggtggacatg
cagaaacaggaagtgatgatatttgagctttcaggaaatgaacacattcaaatgctatcc
aatgatactactatttcatatgtgaaaaagctgctttttaatttgtga

DBGET integrated database retrieval system