KEGG   Gallus gallus (chicken): 768536
Entry
768536            CDS       T01006                                 

Gene name
TAAR1
Definition
(RefSeq) LOW QUALITY PROTEIN: trace amine-associated receptor 1
  KO
K05051  trace amine associated receptor
Organism
gga  Gallus gallus (chicken)
Pathway
gga04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    768536 (TAAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    768536 (TAAR1)
G protein-coupled receptors [BR:gga04030]
 Rhodopsin family
  Biogenic amine
   Trace amine
    768536 (TAAR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 768536
NCBI-ProteinID: XP_015139651
CGNC: 10460
Ensembl: ENSGALG00000013994
Position
3
AA seq 332 aa
MQLCCESVNGSCVKSNWSNSIRISMYIFMVCVILTTVIGNLMVIISISHFKQLHTPTNFL
IISMATADFLLGFLIMPCSMVRSVEHCWYFGDFFCKIHTSTDIMLSTTSIFHLSFISIDR
YYAVCDPLRYKSKINAFVILVMILVSWTVPAAFAFGMIFLELNLLGAKEIYNHTHCAGGC
LVFFSETSGVVTSVVSFYIPGLVMLFIYRKIYSIAKRQXRSIDAVSKKKKRYETKHISFC
RERKAAKTLCIVMGVFLICWSPFFFFTATDPFMNYAAPPVLTDTLVWFGYLNSAFNPIVY
AFFYMWFRRALKTILFGNIFQQDSSRTQLFLE
NT seq 999 nt   +upstreamnt  +downstreamnt
atgcagctgtgctgtgaatcggtaaatggctcttgtgtaaagagcaattggtcaaacagt
atccgtatttccatgtatatcttcatggtttgcgttattctgaccacagtgattggaaat
ctaatggttatcatctcaatatcacattttaagcagctccacactcctaccaacttcctg
ataatttccatggctacagctgactttttgctgggattcctcatcatgccttgcagcatg
gtgcgctctgttgagcactgctggtattttggggacttcttctgcaagatccacacaagc
acagacatcatgctgagcacgacttccatcttccatctttccttcatatccattgatcgt
tactatgctgtgtgtgaccctctcaggtacaaatcaaagataaatgcttttgttatcctg
gtcatgatattggtaagttggactgtccctgcagcttttgcttttgggatgatctttcta
gaactaaatttgctaggggcaaaagagatttataatcacacccattgtgcaggaggatgc
ttggtcttctttagtgaaacttcaggtgtcgttacctccgtagtgtctttttacatccct
ggattagttatgctgttcatctacaggaaaatatactctatagccaaaaggcagncaaga
tccattgatgcagttagcaaaaagaagaaaagatatgaaacgaagcacatttcattctgc
agagaaagaaaagctgcaaagacattatgcatagtaatgggagtatttctcatatgctgg
agcccattcttcttctttacagcaactgatccatttatgaattatgcagcacctcctgtt
ctcactgacactttggtttggtttggttatttaaattctgcatttaatcccattgtttac
gcattcttttacatgtggtttcgcagggcattaaagactattctgtttggaaatattttt
caacaggactcatcaagaactcagttatttttagagtaa

DBGET integrated database retrieval system