KEGG   Gallus gallus (chicken): 768555
Entry
768555            CDS       T01006                                 

Gene name
MVK
Definition
(RefSeq) mevalonate kinase
  KO
K00869  mevalonate kinase [EC:2.7.1.36]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00900  Terpenoid backbone biosynthesis
gga01100  Metabolic pathways
gga04146  Peroxisome
Module
gga_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    768555 (MVK)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    768555 (MVK)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.36  mevalonate kinase
     768555 (MVK)
SSDB
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C GalKase_gal_bdg
Other DBs
NCBI-GeneID: 768555
NCBI-ProteinID: XP_015130996
CGNC: 10362
Ensembl: ENSGALG00000013848
UniProt: E1BZ79
Position
15
AA seq 397 aa
MSEHGLLVSAPGKVILHGEHAVVHGKAALAVALGLRTFLRLRPGGGERLRIHLPGVGVRR
EWDVAELSALRGRLTADFDESKSPGVEQLDVLKEFAGIAADASAPDSLAILAFLYMCLAI
SAKYGDVPSVDIAVWSELPTGAGLGSSAAYAVCLAAALLHACRAISCPLKDGEATARWPE
EEMSLINSWAFQGERVIHGNPSGVDNAVGTWGGALRYQSGKITSLKRVPTLRILLTNTKV
PRSTKVLVAGVKEKILKFPAIMNPVLDSIDAISQECQSVLEAMPTNPSPEYYPVLEELFD
INQHHLNVIGVGHPSLDRLCRVTASHGLHSKLTGAGGGGCGITLLPPDATPLAVEAAKRD
LCACGFECWETDIGAPGVTLHSSSALNAEVLHALSES
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgtcggagcacggcctgctggtgtccgccccggggaaggtgatcctgcacggcgagcac
gccgtggtgcacggcaaggcggccctggccgtggcgctgggcctgcgcaccttcctgcgg
ctgcggcccggcggcggagagcggctccgcattcacctgcctggagtcggcgtgcggagg
gagtgggacgtggccgagctcagcgccctgcggggccgcctcacagctgactttgatgaa
tcaaagtcccccggcgtagaacagctggatgtgctgaaagagtttgctggaatcgctgcc
gatgcctcagctcctgacagccttgcaattcttgcctttctgtatatgtgtctggctatt
tcagctaagtatggagatgttcccagcgtggacatagccgtgtggtccgagctgcccaca
ggagctgggctgggttcgagtgctgcctatgccgtgtgcttggcagcagcactgctgcat
gcctgcagagccatctcctgccctctgaaggacggggaggccacagccaggtggccggaa
gaagagatgagtctgatcaacagctgggccttccagggggagcgcgtgatccacggcaat
ccctcgggtgtggataatgctgttgggacctggggtggagccctgagataccaatcagga
aaaatcacatcgttgaaaagggtgccgacgctgaggatcttgctgaccaacacgaaggtc
ccacgaagcactaaggtcctggtggctggggttaaggagaagatcctgaagttccctgct
ataatgaaccccgtgctggactccatcgatgcaatttctcaggagtgccaaagtgttctg
gaagcgatgcctacaaatccatcaccagagtattaccccgtgctagaggaactgtttgat
ataaaccagcaccatctgaatgtcatcggggtcggccatccttccctggaccgcctgtgc
cgggtgacagcctcgcatggtctgcacagcaagctgaccggggccggcggcggcggctgc
ggcatcaccctactgccaccagatgccaccccgctggccgtggaagcagccaagcgagac
ttgtgtgcctgcggatttgaatgctgggagactgacatcggggcccccggggtgaccctg
cactcctcctcagctttaaacgccgaagtgctgcacgcgctctctgagagttga

DBGET integrated database retrieval system