KEGG   Gallus gallus (chicken): 768558
Entry
768558            CDS       T01006                                 

Gene name
TAAR5
Definition
(RefSeq) LOW QUALITY PROTEIN: trace amine-associated receptor 5
  KO
K05051  trace amine associated receptor
Organism
gga  Gallus gallus (chicken)
Pathway
gga04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    768558 (TAAR5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    768558 (TAAR5)
G protein-coupled receptors [BR:gga04030]
 Rhodopsin family
  Biogenic amine
   Trace amine
    768558 (TAAR5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 768558
NCBI-ProteinID: XP_001231565
CGNC: 10461
Ensembl: ENSGALG00000013995
Position
3
AA seq 342 aa
MGSAQSRSVEKGMLIASCYEVNGSCHRTLHPFGVHLAIYLACALGTLITVLGNLLVVIVV
SHFQALHTPTNFLLLSLALADMLLGLTVLPFSTIRSVESCWYFGDDFCKLHTFLDTLFCL
TSIFHLCFISIDRHCAICDPLLYPTKFTLRVACMCIGVGWAVPMVYTSVFLYTKEIAEGL
GHFLQDVPCVGSCQLLFNKLWGWLNFPVFFFPCLITIALYVKIFTVANKQARLINNMNKS
FGAHLHRGASRSERRAAKTLGVAVGVYXLCWLPFTIDTMIDSLLNFITPPVLFDTLIWFA
YFNSACNPLIYVFSYHWFRKAVKLVLTQGIFCSRTSRVDLYQ
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgggctcagcccagagccgtagtgtggagaaggggatgctcatcgcctcatgctatgag
gtgaacggctcctgtcacagaaccctgcatccctttggggtgcatctggccatctacctg
gcctgtgccttaggcacgttgattacggtgctggggaacctactcgttgtcattgtagtt
tcccatttccaagccctgcacactcccaccaactttctgctcctctcccttgccttggct
gacatgctcctgggactgaccgtgctgcccttcagcactatccggtctgtagagagttgc
tggtattttggagatgacttctgtaaactgcacacctttctggacacactcttttgcctg
acctccatatttcacctgtgtttcatttccatagatcggcactgtgcaatttgtgaccct
ttgctctaccccaccaagtttaccctaagagtggcctgcatgtgcattggggtggggtgg
gcagtccccatggtctacacttctgtcttcctgtacactaaagagattgcagaagggttg
ggccattttttgcaagatgtaccctgtgttggtagctgtcagctgctgttcaataagctc
tgggggtggctgaatttcccagtattcttctttccttgcctaataacgatagctttatat
gtaaaaatatttactgttgctaacaagcaagccagattgataaataacatgaataaaagt
tttggggctcatctacacagaggagcatccagaagtgaaaggagagcagcaaagactctt
ggggtagctgtaggagtctatnctctgtgctggctgccctttactattgacaccatgata
gacagccttctgaatttcatcactcctccagttctgtttgacaccctcatttggtttgca
tactttaattctgcttgcaatcccttgatctatgtgttctcctatcactggttcaggaaa
gctgtgaaactagtattaacacaggggatcttttgttccaggacatcaagagtagacttg
taccagtaa

DBGET integrated database retrieval system