KEGG   Gallus gallus (chicken): 768711
Entry
768711            CDS       T01006                                 

Gene name
TIMP4
Definition
(RefSeq) metalloproteinase inhibitor 4 isoform X1
  KO
K22584  metalloproteinase inhibitor 4
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    768711 (TIMP4)
Peptidases and inhibitors [BR:gga01002]
 Peptidase inhibitors
  Family I35: timp family
   768711 (TIMP4)
SSDB
Motif
Pfam: TIMP NTR
Other DBs
NCBI-GeneID: 768711
NCBI-ProteinID: XP_001232059
CGNC: 3693
Ensembl: ENSGALG00000004969
UniProt: A0A1D5NY77
Position
12
AA seq 221 aa
MNPVLSTLLFSVLLLLTHRIQELVEACSCAPAHPQQLICDSALVIRAKISSEKVVPASDD
PLNTHKMIRYEIKQIKMFKGFEKLKDVQYVYTPFDSSLCGVKLEANNKKQYLLTGQILND
GKVLIHLCNYIEPWDDLSLSQKKSLNQRYQMGCGCKITTCYMVPCSITAPNECLWTDWLI
ERKLYGHQAKHYACIKRSDGTCSWYRGGPPPEKEFIDISEP
NT seq 666 nt   +upstreamnt  +downstreamnt
atgaatcctgtacttagtaccttgttgttttcagtgcttctgctgctgacccacagaatt
caggagctggtggaggcgtgcagctgtgcccctgctcatccgcagcagctcatctgcgat
tctgctttagtgattcgagcaaaaatatccagtgaaaaggtggttcctgccagcgacgat
cctctcaatacccacaaaatgatccggtatgaaatcaaacaaataaagatgtttaaagga
tttgaaaagctcaaggatgtccagtatgtctatactccttttgattcatcactctgcgga
gtgaaactagaagcaaacaacaaaaaacagtaccttttgacaggccagattttaaatgat
ggtaaagtcctcatccatttatgcaactacattgaaccatgggatgatttatccttgtct
caaaagaagagtcttaaccagagatatcaaatgggctgtggctgcaaaattactacctgc
tacatggtgccctgctcaatcactgcaccaaatgagtgcctctggacagactggctgata
gaaagaaagctatacgggcaccaggccaagcattacgcctgtatcaagagaagtgatggc
acttgcagctggtaccgaggtggccctcccccagagaaagagtttattgacatcagcgaa
ccttaa

DBGET integrated database retrieval system