KEGG   Gallus gallus (chicken): 769005
Entry
769005            CDS       T01006                                 
Symbol
AFMID
Name
(RefSeq) kynurenine formamidase isoform X1
  KO
K01432  arylformamidase [EC:3.5.1.9]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00380  Tryptophan metabolism
gga00630  Glyoxylate and dicarboxylate metabolism
gga01100  Metabolic pathways
gga01240  Biosynthesis of cofactors
Module
gga_M00038  Tryptophan metabolism, tryptophan => kynurenine => 2-aminomuconate
gga_M00912  NAD biosynthesis, tryptophan => quinolinate => NAD
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    769005 (AFMID)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    769005 (AFMID)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.9  arylformamidase
     769005 (AFMID)
SSDB
Motif
Pfam: BD-FAE Abhydrolase_3 COesterase Abhydrolase_6 Hydrolase_4 Lipase_3 LIDHydrolase FSH1 Peptidase_S9 NYN
Other DBs
NCBI-GeneID: 769005
NCBI-ProteinID: XP_004946352
CGNC: 52
Ensembl: ENSGALG00000000109
UniProt: E1C2H6
Position
18:complement(9856714..9860225)
AA seq 293 aa
MGRWQDMDLEELEEQYSPSRWSRRMDSESVIQAHIDVTTAGTQKARAAAHTLLHVPYGDG
EGEKLDIYFPADSSETFPVFVYIHGGYWQCLSKDASGFAAPALLSQGVAVVALGYDIAPR
GHMDAMVLQVRRSLAFLVKQYHRIRGIYLCGHSAGAHLAAMVLSTDWTEFGVVPDIRGAV
LVSGVYDLEPLLHTYVNDALNMSLEVAQRNSPILCVTQAVPVAASCEVLVAVAQHDSPEF
RRQSQEYSQALRSAGWSVSLLDLASVDHFDIIEKLSEETYVLTQVILNMIARA
NT seq 882 nt   +upstreamnt  +downstreamnt
atggggcggtggcaggacatggatttggaggagctggaggagcagtactcgcccagccgc
tggtcccgccgcatggacagcgagagcgtcatccaggcccacatcgatgtgacgaccgca
ggaacgcagaaggcccgggctgctgcacataccttgctgcacgttccctatggagatggg
gagggggagaagcttgacatttattttcctgcggactcttctgaaaccttcccggtcttt
gtctacatccatggtggatactggcagtgcttgagtaaggatgcgtcaggtttcgcagcc
cctgcgctgctgtctcagggtgttgctgttgtggccttgggttacgacattgctcccaga
ggccacatggatgcgatggtgctccaggtgcggcgcagccttgccttcctggtgaagcaa
taccacaggatcaggggtatttacttgtgtggacactcggcaggggctcacctggcagcc
atggtcttgtccacggactggacagaatttggtgtggttccagatatcagaggagctgtt
ctggtgagtggtgtgtatgacctggagccccttctgcacacctacgtgaatgatgcactg
aacatgagcctggaagtggcccagaggaacagtcccatcctgtgtgtcacacaagcagtg
cctgtggctgcatcctgtgaggtgcttgtggctgtggcccagcacgactccccggagttc
cgcaggcagtcacaggagtacagccaggctctgcgctcggctggttggtctgtctctctg
ttggatcttgccagcgtggatcactttgacatcattgagaagctgtcagaggaaacttac
gtcctgactcaggtcatcctgaacatgattgcgagagcttga

DBGET integrated database retrieval system